| Clone Name | rbastl43a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (... | 42 | 5e-04 | 2 | BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (... | 36 | 0.032 | 3 | LEG_ANTCR (P22031) D-galactoside-specific lectin (Sea urchin egg... | 34 | 0.12 |
|---|
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 42.4 bits (98), Expect = 5e-04 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 416 CGSYSHGECSSSQALAVAQEACXXXXXXXXXXSAKNFG-DPCRGVTKSLVVEAACS 252 CG++ G C + ++ ++ C + +NFG DPCR V K L VEA CS Sbjct: 780 CGNFQQGSCHAPRSYDAFKKNCVGKESCSVQVTPENFGGDPCRNVLKKLSVEAICS 835
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 36.2 bits (82), Expect = 0.032 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = -2 Query: 419 TCGSYSHGECSSSQAL-AVAQEA----CXXXXXXXXXXSAKNFG-DPCRGVTKSLVVEAA 258 TCGS+S G C + ++ A QE C + + FG DPC G K L VEA Sbjct: 771 TCGSFSEGSCHAHKSYDAFEQEGLMQNCVGQEFCSVNVAPEVFGGDPCPGTMKKLAVEAI 830 Query: 257 C 255 C Sbjct: 831 C 831
>LEG_ANTCR (P22031) D-galactoside-specific lectin (Sea urchin egg lectin)| (SUEL) Length = 105 Score = 34.3 bits (77), Expect = 0.12 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -2 Query: 395 ECSSSQALAVAQEACXXXXXXXXXXSAKNFGDPCRGVTKSLVVEAACS 252 +C SS + V + +C S FGDPC G K L V CS Sbjct: 56 KCRSSNSQQVVENSCEGKSSCTVLASNSVFGDPCPGTAKYLAVTYICS 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,221,691 Number of Sequences: 219361 Number of extensions: 1028516 Number of successful extensions: 1884 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1877 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)