| Clone Name | rbastl42d01 |
|---|---|
| Clone Library Name | barley_pub |
>K6PF2_SYNY3 (Q55988) 6-phosphofructokinase 2 (EC 2.7.1.11) (Phosphofructokinase| 2) (Phosphohexokinase 2) Length = 384 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -3 Query: 284 LLQAFASEDGQYAVKMLLSGGL-IVVIPRITPCLSL*L---AVLLFVTVRRSGLMSLSIV 117 ++Q + G + ++GG I++IP ITPCL+ + + +R+SG IV Sbjct: 184 IVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRNCCYQLMNLRKSGRHFALIV 243 Query: 116 LDAG 105 + G Sbjct: 244 ISEG 247
>ZNF73_HUMAN (O43830) Zinc finger protein 73 (Zinc finger protein 186) (hZNF2)| Length = 326 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 5 SQAGYLTLHNKIFHQHASKTWQVMISCQHIISWIQHLTR*T 127 SQ YLT+H H + TWQ +C H H ++ T Sbjct: 183 SQKSYLTIH------HRTHTWQKPYACDHCEKAFSHKSKLT 217
>NU2M_NEUCR (Q35140) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 583 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 400 FIAAIVLYVTPLQVLAALGGFYAMRHPRFRHRLP 299 FI I + + L + FY MRHPRF ++ P Sbjct: 70 FIFLISILILQLTSFDPIKKFYIMRHPRFINKWP 103
>Y109_MYCPN (P75453) Protein MPN109 (C09_orf165)| Length = 165 Score = 27.3 bits (59), Expect = 9.0 Identities = 22/69 (31%), Positives = 31/69 (44%) Frame = +1 Query: 25 ITQQDISPTCFQNLASHDKLSAHYFLDPASNTIDRLISPERRTVTNNNTASYSDRHGVIL 204 I Q+D C+Q+L H + S Y LD +NT L + + HGV + Sbjct: 11 INQKD----CWQSLIDHKERS--YSLDFVNNTEKEL------PLIYGYEVKDFENHGVKI 58 Query: 205 GITTIRPPD 231 G TT +P D Sbjct: 59 GYTTCKPSD 67
>Y1067_METMP (Q6LYC4) Putative iron-sulfur protein MMP1067| Length = 494 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 308 QVAFNAGKLLQAFASEDGQYAVKMLLSGGLIVVIPRITPC 189 +VAF G L+ E G+ A+++L + G+ V+IP+ C Sbjct: 264 RVAFFTGCLVDFRLQEIGKSAIRVLNAHGVSVIIPKNQVC 303
>TRIM6_HUMAN (Q9C030) Tripartite motif protein 6 (RING finger protein 89)| Length = 488 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -3 Query: 377 RHTAPGSRSIRRVLCHEAPKVQAQVAFNAGKLLQAFASEDGQ 252 RH A R +R V+ +++A + + G+ LQ F EDG+ Sbjct: 72 RHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGK 113
>Y092_METJA (Q57557) Putative iron-sulfur protein MJ0092| Length = 489 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -3 Query: 332 HEAPKVQAQVAFNAGKLLQAFASEDGQYAVKMLLSGGLIVVIPRITPC 189 + A + +VAF G L+ G+ A+K+L + G+ VVIP+ C Sbjct: 253 YPAESEKLRVAFFTGCLVDFRLQNVGKDAIKVLNAHGVSVVIPKNQVC 300
>PARC_HUMAN (Q8IWT3) p53-associated parkin-like cytoplasmic protein| (UbcH7-associated protein 1) Length = 2517 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -3 Query: 350 IRRVLCHEAPKVQAQVAFNAGKLLQAFASEDGQYAVKMLLS 228 + +LC+ P+++ +AGK+LQA A+ D +LLS Sbjct: 171 LMHMLCNPEPQIRR----SAGKMLQALAAHDAGSRAHVLLS 207 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,787,793 Number of Sequences: 219361 Number of extensions: 1142133 Number of successful extensions: 2786 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2786 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)