| Clone Name | rbastl41h05 |
|---|---|
| Clone Library Name | barley_pub |
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 38.5 bits (88), Expect = 0.007 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 419 IRIRSKTQGIALSLGDKITLKQK 351 IRIR+K+QG+ALSLGDKI L QK Sbjct: 927 IRIRAKSQGMALSLGDKINLSQK 949
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 38.5 bits (88), Expect = 0.007 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 419 IRIRSKTQGIALSLGDKITLKQK 351 IRIR+K+QG+ALSLGDKI L QK Sbjct: 927 IRIRAKSQGMALSLGDKINLSQK 949
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 38.5 bits (88), Expect = 0.007 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 419 IRIRSKTQGIALSLGDKITLKQK 351 IRIR+K+QG+ALSLGDKI L QK Sbjct: 927 IRIRAKSQGMALSLGDKINLSQK 949
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 36.6 bits (83), Expect = 0.025 Identities = 17/23 (73%), Positives = 21/23 (91%) Frame = -2 Query: 419 IRIRSKTQGIALSLGDKITLKQK 351 IRIR+K+QG+ALSLGDKI+ QK Sbjct: 936 IRIRAKSQGMALSLGDKISSSQK 958
>COPB_YEAST (P41810) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 973 Score = 33.5 bits (75), Expect = 0.21 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -2 Query: 419 IRIRSKTQGIALSLGDKITLKQK 351 +RIRSK QG+ALSLGD++ L K Sbjct: 941 VRIRSKGQGLALSLGDRVALIAK 963
>COPB_SCHPO (Q9UUF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 940 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -2 Query: 419 IRIRSKTQGIALSLG 375 +RIRSKTQGIALSLG Sbjct: 923 VRIRSKTQGIALSLG 937
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 3.9 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 160 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133
>INP4A_RAT (Q62784) Type I inositol-3,4-bisphosphate 4-phosphatase (EC| 3.1.3.66) (Inositol polyphosphate 4-phosphatase type I) Length = 939 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 287 LAKWTSYMTQLQQIASQLNCLPSA*G*SCLPS*VQFLG 400 L + SY Q +++ + +CLP + +CLP ++FLG Sbjct: 789 LVRLNSYFEQFKEVLPE-DCLPRSRSQTCLPELLRFLG 825
>INP4A_MOUSE (Q9EPW0) Type I inositol-3,4-bisphosphate 4-phosphatase (EC| 3.1.3.66) (Inositol polyphosphate 4-phosphatase type I) Length = 939 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 251 TSLLAHCTGSMKLAKWTSYMTQLQQIASQLNCLPSA*G*SCLPS*VQFLG 400 TSL G L + SY Q +++ + +CLP + +CLP ++FLG Sbjct: 778 TSLQEGINGE-SLVRVNSYFEQFKEVLPE-DCLPRSRSQTCLPELLRFLG 825
>INP4A_HUMAN (Q96PE3) Type I inositol-3,4-bisphosphate 4-phosphatase (EC| 3.1.3.66) (Inositol polyphosphate 4-phosphatase type I) Length = 977 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 287 LAKWTSYMTQLQQIASQLNCLPSA*G*SCLPS*VQFLG 400 L + SY Q +++ + +CLP + +CLP ++FLG Sbjct: 827 LVRLNSYFEQFKEVLPE-DCLPRSRSQTCLPELLRFLG 863
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDH 142 + R+ PE ++L TPTQ F +HR+ K+A + KG+ H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,276,533 Number of Sequences: 219361 Number of extensions: 1030960 Number of successful extensions: 2633 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2633 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)