| Clone Name | rbastl41h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxyla... | 27 | 9.9 |
|---|
>GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxylating] subunit 2| (EC 1.4.4.2) (Glycine decarboxylase subunit 2) (Glycine cleavage system P-protein subunit 2) Length = 492 Score = 27.3 bits (59), Expect = 9.9 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -3 Query: 255 LQPFGE*SLRMCGTARVRNG--LRSIFSVHNFVPVIAFCLHPFVLLGAKVKRAVLR 94 ++ G LR A V N +++ H +P +C H FVL G+K K +R Sbjct: 342 IRTMGAEGLREVSEAAVLNANYIKASLKDHYEIPYEQYCKHEFVLSGSKQKEHGVR 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,725,809 Number of Sequences: 219361 Number of extensions: 910022 Number of successful extensions: 1919 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1919 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)