| Clone Name | rbastl41c02 |
|---|---|
| Clone Library Name | barley_pub |
>YR840_MIMIV (Q5URB9) Putative ankyrin repeat protein R840| Length = 526 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 286 VDLFKYLLPNGVDVKSHLAYVAALAC 209 +++ KYL+ NGVD++S Y +AC Sbjct: 122 IEVVKYLIDNGVDIRSEKNYAVRIAC 147
>IBP1_BOVIN (P24591) Insulin-like growth factor-binding protein 1 precursor| (IGFBP-1) (IBP-1) (IGF-binding protein 1) Length = 263 Score = 29.3 bits (64), Expect = 5.0 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -2 Query: 210 AQRFWVCSH-PAFCPSAARSA*CGFITLAWTS*IAVCCHGTPSKYVHISCSILSNEP 43 A+R +C PA CP RSA CG + A C T +SC L EP Sbjct: 37 AERMALCPPVPASCPELTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEP 93
>CD53_MOUSE (Q61451) Leukocyte surface antigen CD53 (Cell surface glycoprotein| CD53) Length = 218 Score = 28.9 bits (63), Expect = 6.6 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 314 LEGASGQSGQPAMSCSSGSTVRGCCSCNPSLFRQSV**SGMLLVSPC 454 + G+S + P SC SG+ V+GC + S F + G++ + C Sbjct: 146 VNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSNFLYIGIITICVC 192
>SECB_BRAJA (Q89WN7) Protein-export protein secB| Length = 161 Score = 28.9 bits (63), Expect = 6.6 Identities = 11/42 (26%), Positives = 28/42 (66%) Frame = +1 Query: 193 HPKSLCMLKRQHKPGEISHLLRLGANT*TDQQFSLSVGVQSR 318 +P + L++Q +P +I+ + +GAN ++Q+F +++ V+ + Sbjct: 31 NPNAPSSLQQQGQPPQINIQINVGANNLSEQEFEVTLSVEGK 72
>MURG_STRCO (Q9ZBA5) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 364 Score = 28.9 bits (63), Expect = 6.6 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 8/53 (15%) Frame = -2 Query: 411 LKRLGLQLQH---PRTVLPELHDMAGCPDCPLAP----SRLD-PYRKGELLIC 277 L++ G+Q+ H P+ LP++H M G P P P R+D Y ++++C Sbjct: 212 LQQAGIQILHAVGPKNELPQVHQMPGMP--PYIPVSYLDRMDLAYAAADMMLC 262
>MURG_STRAW (Q820F6) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 363 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = -2 Query: 411 LKRLGLQLQH---PRTVLPELHDMAGCPDCPLAP--SRLD-PYRKGELLIC 277 L++ G+Q+ H P+ +P++H M G P P R+D Y ++++C Sbjct: 212 LQQAGIQILHAVGPKNEMPQVHQMPGMPPYIPVPYVDRMDLAYAAADMMLC 262
>RNS1D_RATRT (Q8VD86) Ribonuclease pancreatic delta-type precursor (EC 3.1.27.5)| (RNase 1 delta) Length = 150 Score = 28.5 bits (62), Expect = 8.6 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -2 Query: 459 KKQGDTSNMPLHHTDCLKRLGLQLQHPR----TVLPELHDMAGCPDCPLAPSRLD 307 KK S+ PLH T+C RL ++P+ T + H + C PL P LD Sbjct: 95 KKNCHKSSSPLHITEC--RLKGSSKYPKCDYTTTNSQKHIIIACEGNPLVPVHLD 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,831,052 Number of Sequences: 219361 Number of extensions: 1522345 Number of successful extensions: 3662 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3661 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)