| Clone Name | rbastl40h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MRL1_YEAST (Q06815) Mannose 6-phosphate receptor-like protein 1 ... | 32 | 0.56 | 2 | UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC ... | 29 | 2.8 |
|---|
>MRL1_YEAST (Q06815) Mannose 6-phosphate receptor-like protein 1 precursor| Length = 381 Score = 31.6 bits (70), Expect = 0.56 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 19 GTSVRMLLLNRISENTKEIKLCCNFGIGLYYCSYYTQVQTVQTCPRSTK 165 G + LLN + + + K ++ L+ CSY+ +V+++ CP S K Sbjct: 185 GKDKKATLLNFVCDKEIQSKAQISYIGNLHNCSYFFEVRSIHACPTSNK 233
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 201 HSFRCFTCKVVNFGATRTCLYCLYLG 124 ++ +C TC +N GAT CL C + G Sbjct: 42 NTMKCGTCHEINSGATFMCLQCGFCG 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,930,437 Number of Sequences: 219361 Number of extensions: 695067 Number of successful extensions: 1768 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1766 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)