| Clone Name | rbastl40d04 |
|---|---|
| Clone Library Name | barley_pub |
>OREX_RAT (O55232) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 130 Score = 30.8 bits (68), Expect = 1.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 320 RQSPIAVDPGPCPGERCPAAFASLM 394 R++ ++P PCPG RCP A A+ + Sbjct: 98 RRAGAELEPYPCPGRRCPTATATAL 122
>RNB_BUCAI (P57354) Exoribonuclease 2 (EC 3.1.13.1) (Exoribonuclease II)| (Ribonuclease II) (RNase II) Length = 649 Score = 28.5 bits (62), Expect = 6.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 160 KNGDISTCIHKFCTLNKAKPKFNLEHISD 246 KNG+IS I F K+K K + +H+SD Sbjct: 291 KNGNISNKIEFFLAWIKSKSKLSYDHVSD 319
>PUR6_CANAL (Q92210) Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21)| (AIR carboxylase) (AIRC) Length = 568 Score = 28.5 bits (62), Expect = 6.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 39 IYTPFKIPNTLFGKHILLATNQLHNFP 119 +Y P +IP+TL K +LA N + +FP Sbjct: 222 VYAPARIPDTLGQKASILAKNAVKSFP 248
>ACC2A_BRARE (Q708S8) Amiloride-sensitive cation channel 2-A, neuronal| (Acid-sensing ion channel 1.1) (ZASIC1.1) Length = 557 Score = 28.5 bits (62), Expect = 6.4 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +2 Query: 314 NERQSPIAVDP----GPCPGERCPAAFASLMXRHHPG 412 NER + +++D PC R P+ + + M HHPG Sbjct: 512 NERGAVLSLDDVKRHAPCDNLRTPSTYPANMLPHHPG 548
>YGZG_YEAST (P53054) Hypothetical protein YGL262W| Length = 175 Score = 28.5 bits (62), Expect = 6.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 3 NHVTELFKESCQIYTPFKIPNTLFGKHIL 89 N+VTEL + TP +P+TL G H L Sbjct: 3 NNVTELVNSIIGVQTPGSLPDTLSGAHSL 31
>EP45_XENLA (Q00387) Estrogen-regulated protein EP45 precursor| Length = 436 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = +1 Query: 49 LLKFQIHSLESTSCLPLTNYTIFLFTF*NNYQPTMNRKN 165 +++ I L+S + + L NY ++ + NN+ PT+ +K+ Sbjct: 213 VIQEMIRELDSNTEMVLVNYVLYKGEWANNFNPTLTQKS 251
>COAT_CVB (P37991) Coat protein (Capsid protein) (CP)| Length = 315 Score = 28.1 bits (61), Expect = 8.3 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 276 GSSPTPPPSTKDRTSVNHRLRWIQVLVLESVAQQLL 383 GS+PTPPP RT+ RLR + + E +QLL Sbjct: 16 GSTPTPPPPPPARTAEEARLR-LAEMEREREQEQLL 50
>HXKL_ARATH (Q9T071) Probable hexokinase (EC 2.7.1.1)| Length = 493 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 68 TLWKAHLACH*PITQFSSSLSETITNP 148 T W +CH PIT+F +SL NP Sbjct: 283 TEWGDFRSCHLPITEFDASLDAESLNP 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,214,590 Number of Sequences: 219361 Number of extensions: 1239667 Number of successful extensions: 3331 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3330 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)