| Clone Name | rbastl40c02 |
|---|---|
| Clone Library Name | barley_pub |
>YRD3_CAEEL (Q09573) Hypothetical protein K02A2.3| Length = 1020 Score = 30.4 bits (67), Expect = 1.8 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 334 YWP*QVSHCSGTKPFRGLRGPVPSLPYGSISGALSCSAIY 215 Y+P +GT LR P S+P G+I+ L+ SAIY Sbjct: 386 YFPAVTGIFTGTNMSGDLRDPQRSIPVGTIAATLTTSAIY 425
>FNBP2_MOUSE (Q91Z67) SLIT-ROBO Rho GTPase-activating protein 2 (srGAP2)| (Formin-binding protein 2) (Formin-binding protein 27) (FBP 27) (Fragment) Length = 405 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +3 Query: 174 QHDCTTLCKSLLER*MAEHDKAPEMLP*GREGTGPLKPRNGFVPEQCETCHGQ 332 Q C + L++ + +H+ + P RE GP+ R G + + C++ HG+ Sbjct: 226 QVSCQSHVNELIKTIIIQHEN---IFPNPRELEGPIYSRGGSMEDYCDSTHGE 275
>ELO1_YEAST (P39540) Elongation of fatty acids protein 1| Length = 310 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -3 Query: 267 LLFLMVAFQVLYHALPSIFLKETCTM*CNHAVNI*KRLAKCSNRDTRMIFTFVSCF 100 +L L+V + VLY + + + K CT C + +A + T +F F+S + Sbjct: 236 MLDLIVVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFISFY 291
>RORG_HUMAN (P51449) Nuclear receptor ROR-gamma (Nuclear receptor RZR-gamma)| Length = 518 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -2 Query: 256 YGSISGALSCSAIYLSKRDLHNVVQSCC*HLKETCKM 146 YGS S + A Y S ++ ++VQS C +ETC++ Sbjct: 251 YGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQL 287
>KCTD9_HUMAN (Q7L273) Potassium channel tetramerisation domain-containing| protein 9 Length = 389 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +1 Query: 82 HPEMTLKTANKGEDHSCISITTFCKSLLDVNSMIALHCASL 204 H E+ +K + EDHS IS F + LL + L C L Sbjct: 183 HLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQGL 223
>TRPA1_DROME (Q7Z020) Transient receptor potential cation channel subfamily A| member 1 (Ankyrin-like with transmembrane domains protein 1) (dANKTM1) Length = 1197 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 151 CKSLLDVNSMIALHCASLF*KDRWQSMI----KHLKCYHKEEKGPALLS 285 C S DV M LHCAS+F S + + KE + P LL+ Sbjct: 329 CLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLA 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,335,273 Number of Sequences: 219361 Number of extensions: 1029918 Number of successful extensions: 2285 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2285 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)