| Clone Name | rbastl40b06 |
|---|---|
| Clone Library Name | barley_pub |
>RL14_GRIJA (Q7XYA7) 60S ribosomal protein L14| Length = 133 Score = 33.1 bits (74), Expect = 0.36 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 3/65 (4%) Frame = -2 Query: 405 LLLKDILDQR---LDPPTEQLAEEVVFIVRIALACTRVNPESRPAMRSVAQEISAHTQAY 235 +++ DILDQ +D P+ L +V+ + RIAL +V+ +R A VA+ S +T A Sbjct: 25 VVIVDILDQNRILVDSPSHGLKRKVINVKRIALTSIKVDDIARGA--PVAEVKSKYTAAK 82 Query: 234 LSEAF 220 + E F Sbjct: 83 VDETF 87
>RLK5_ARATH (P47735) Receptor-like protein kinase 5 precursor (EC 2.7.11.1)| Length = 999 Score = 32.7 bits (73), Expect = 0.47 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = -2 Query: 399 LKDILDQRLDPPTEQLAEEVVFIVRIALACTRVNPESRPAMRSVA---QEIS 253 L+ ++D +LD + EE+ ++ I L CT P +RP+MR V QE+S Sbjct: 920 LEPVIDPKLDL---KFKEEISKVIHIGLLCTSPLPLNRPSMRKVVIMLQEVS 968
>SIRK_ARATH (O64483) Senescence-induced receptor-like serine/threonine-protein| kinase precursor (FLG22-induced receptor-like kinase 1) Length = 876 Score = 29.6 bits (65), Expect = 4.0 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 13/79 (16%) Frame = -2 Query: 453 DLLTSLPAISSSQEDDLLLKD-------------ILDQRLDPPTEQLAEEVVFIVRIALA 313 +++T PAI+SS+ + + + D I+DQRL + + IALA Sbjct: 766 EVITGQPAIASSKTEKVHISDHVRSILANGDIRGIVDQRLRERYD--VGSAWKMSEIALA 823 Query: 312 CTRVNPESRPAMRSVAQEI 256 CT RP M V E+ Sbjct: 824 CTEHTSAQRPTMSQVVMEL 842
>GGA1_HUMAN (Q9UJY5) ADP-ribosylation factor-binding protein GGA1| (Golgi-localized, gamma ear-containing, ARF-binding protein 1) (Gamma-adaptin-related protein 1) Length = 639 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 444 TSLPAISSSQEDDLLLKDILDQRLDPPTEQLAEE 343 TSLPA S + DLL K +L Q L P ++Q+ E Sbjct: 412 TSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWE 445
>L_NDVB (P11205) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2204 Score = 29.3 bits (64), Expect = 5.2 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = -2 Query: 438 LPAISSSQEDDLLLKDILDQRLDPPTEQLAEEVVFIVRIALACTRVNPESRPAMRSVAQE 259 + + S + DLL +LD L+ QL + + + A TR P+ R S ++ Sbjct: 1557 ISGLYSGNKYDLLFPSVLDDNLNEKMLQLISRLCCLYTVLFATTREIPKIRGL--SAEEK 1614 Query: 258 ISAHTQAYLSEAFR 217 S T+ LS+A + Sbjct: 1615 CSVLTEYLLSDAVK 1628
>AVT5_YEAST (P38176) Vacuolar amino acid transporter 5| Length = 509 Score = 29.3 bits (64), Expect = 5.2 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 16 LFYQSYRNMLS*CWSLAGKPTHKVLEDLKLYFTELISLQFSPACVD-SESLLKGASLLVV 192 +FY++ NM +G H + D +LY T +I SP C S + L+ AS++ + Sbjct: 164 IFYRNDDNM-------SGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMIAI 216 Query: 193 C*FAY 207 AY Sbjct: 217 VSVAY 221
>BAK1_ARATH (Q94F62) BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor (EC 2.7.11.1) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) Length = 615 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 348 EEVVFIVRIALACTRVNPESRPAMRSVAQ 262 EEV ++++AL CT+ +P RP M V + Sbjct: 533 EEVEQLIQVALLCTQSSPMERPKMSEVVR 561
>1433_TOBAC (Q41246) 14-3-3-like protein| Length = 251 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +3 Query: 27 ELSQYALLMLVFGRQTDTQST*GFETVFYRINKSAIFTCLCRFRISAQR 173 EL++YAL + V ST G TVFY K + L F+ R Sbjct: 93 ELTKYALTLSVIDEHVVPSSTSGESTVFYYKMKGDYYRYLAEFKSGDDR 141 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,692,986 Number of Sequences: 219361 Number of extensions: 1264971 Number of successful extensions: 3095 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3095 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)