| Clone Name | rbastl40b03 |
|---|---|
| Clone Library Name | barley_pub |
>GCP4_ARATH (Q9M350) Gamma-tubulin complex component 4 homolog| Length = 745 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -3 Query: 275 AAWQHGNH-DLQKRREDGEQGPFAQQTRKWKMEMTRLTFHIAHFLSSICISVQVD 114 A+ H +H + + R+DG G +QQ R+ M R+ H+A + ++ +QVD Sbjct: 553 ASVMHQDHIESAQHRKDGLNGSTSQQRRQGIRPMWRVREHMAFLIRNLQFYIQVD 607
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 254 HDLQKRREDGEQGPFAQQTRKWKMEMTRLTFHIAHFLSSIC 132 HD K R DG+ P + R K M L + + HF C Sbjct: 4466 HDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNC 4506
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 254 HDLQKRREDGEQGPFAQQTRKWKMEMTRLTFHIAHFLSSIC 132 HD K R DG+ P + R K M L + + HF C Sbjct: 4468 HDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNC 4508
>BHLH3_RAT (O35779) Class B basic helix-loop-helix protein 3 (bHLHB3)| (Enhancer-of-split and hairy-related protein 1) (SHARP-1) Length = 410 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 297 ASLLAHLSGMAAWKP*PAETKGRWRARAVCSADQEMENGND 175 A L++HL +A P T GR RA CSA +G++ Sbjct: 160 AQLVSHLHAVATQLLTPQVTPGRGPGRAPCSAGAAAASGSE 200
>MAUG_METFL (Q50426) Methylamine utilization protein mauG precursor| Length = 333 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 274 RHGSMETMTCRNEGKMASKGRLLSRPGNG 188 R GSM TC N G S GR+L +G Sbjct: 63 RDGSMSCATCHNPGMRWSDGRILPLRADG 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,994,656 Number of Sequences: 219361 Number of extensions: 861403 Number of successful extensions: 1765 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1765 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)