| Clone Name | rbastl39f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | XIST_MOUSE (P27571) X inactive-specific transcript protein (Frag... | 32 | 0.76 | 2 | IRK1_CAEEL (P52192) Inward rectifier potassium channel irk-1 | 30 | 2.9 | 3 | AKAP3_HUMAN (O75969) A-kinase anchor protein 3 (Protein kinase A... | 29 | 4.9 |
|---|
>XIST_MOUSE (P27571) X inactive-specific transcript protein (Fragment)| Length = 298 Score = 32.0 bits (71), Expect = 0.76 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = -2 Query: 292 VCLDIANSIWSVLLCC-NKFIPQRLVGVHCLPEASVPSFFAGVCIFC*PCSVPFVLFMLH 116 VCL + ++ +L C N + L CL + VC+FC C +P +F+LH Sbjct: 59 VCLCLPCFVYLLLPCVSNSLLHLFLPSFACL-------LLSFVCLFCLQCVLPIPMFLLH 111 Query: 115 ALAVISCEGM 86 V+SC + Sbjct: 112 ---VLSCRAL 118
>IRK1_CAEEL (P52192) Inward rectifier potassium channel irk-1| Length = 505 Score = 30.0 bits (66), Expect = 2.9 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -3 Query: 360 LSAVYSCMLLPVQLYHTFNHSNKFASTSPTAFGRY--FYAVTNLSLKDWLVSIAFQR 196 L +VYS L V+ +HT + +++ +T G A+ L L+ ++V I F + Sbjct: 157 LDSVYSSFLFAVETHHTIGYGHRYITTECYLAGAIVCLQAICALLLQSFMVGIVFAK 213
>AKAP3_HUMAN (O75969) A-kinase anchor protein 3 (Protein kinase A-anchoring| protein 3) (PRKA3) (A-kinase anchor protein 110 kDa) (AKAP 110) (Sperm oocyte-binding protein) (Fibrousheathin I) (Fibrous sheath protein of 95 kDa) (FSP95) Length = 853 Score = 29.3 bits (64), Expect = 4.9 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = +2 Query: 146 ARSTKNTYPRKKRRYRGLWKAMDTNQSLRDKFVTA*KYRPNAVGDVEANLLEWLKV 313 AR +PR+++R+RG + D S+ + +T Y + V D+ ++++ LK+ Sbjct: 254 AREGGRFFPRERKRFRGQERPDDFTASVSEGIMT---YANSVVSDMMVSIMKTLKI 306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,107,138 Number of Sequences: 219361 Number of extensions: 1365555 Number of successful extensions: 3529 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3528 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)