| Clone Name | rbastl39f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HPS5_HUMAN (Q9UPZ3) Hermansky-Pudlak syndrome 5 protein (Alpha-i... | 30 | 3.2 | 2 | POLN_WEEV (P13896) Nonstructural polyprotein (Polyprotein nsP123... | 28 | 9.4 | 3 | DEGS_BACSU (P13799) Sensor protein degS (EC 2.7.13.3) | 28 | 9.4 |
|---|
>HPS5_HUMAN (Q9UPZ3) Hermansky-Pudlak syndrome 5 protein (Alpha-integrin-binding| protein 63) (Ruby-eye protein 2 homolog) (Ru2) Length = 1129 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 288 RFDWLSVPVIL*NPPCSSSLVKG--RRPHSQLRSW 386 R DWL + V L PP +S++ RPHS L SW Sbjct: 920 RLDWLLLAVSLDAPPSTSTMDDEGYPRPHSHLLSW 954
>POLN_WEEV (P13896) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2466 Score = 28.1 bits (61), Expect = 9.4 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +3 Query: 12 SGLRNS*NMKVSSAGRKSSMPT-PVVPAV*CAIHTECCKGLWKWKIKKVFRERGKDNLT 185 S L+ S K+S +K PT ++ +V I+TE L W + VF +GK N T Sbjct: 213 SDLQESRLGKLSILRKKRLQPTNKIIFSVGSTIYTEDRSLLRSWHLPNVFHLKGKSNFT 271
>DEGS_BACSU (P13799) Sensor protein degS (EC 2.7.13.3)| Length = 385 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 283 YDVKRELETCNRSFCALVAKDRTDIPHGLLTNDVRL 176 +D+K E N+SF L K+R D+ G +T D ++ Sbjct: 336 FDLKEAKEKKNKSFGLLGMKERVDLLEGTMTIDSKI 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,554,964 Number of Sequences: 219361 Number of extensions: 1254290 Number of successful extensions: 3069 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3066 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)