| Clone Name | rbastl39e09 |
|---|---|
| Clone Library Name | barley_pub |
>ISN1_SCHPO (O14349) IMP-specific 5'-nucleotidase 1 (EC 3.1.3.-)| Length = 405 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 171 LADDGLEYVALDGNADVERLGPARVP--PCCHNLLQLLLRG 287 LAD+GL+ V+ DG+ + G +P P L+QLL RG Sbjct: 136 LADNGLDMVSFDGDVTLYEDGQPLLPDNPVISRLIQLLSRG 176
>KS6B2_MOUSE (Q9Z1M4) Ribosomal protein S6 kinase beta-2 (EC 2.7.11.1) (S6K-beta| 2) (70 kDa ribosomal protein S6 kinase 2) (p70-S6KB) (p70 ribosomal S6 kinase beta) (p70 S6Kbeta) (S6K2) Length = 485 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +3 Query: 165 GELADDGLE----YVALDGNADVERLGPARVPPCCHNLLQLLLRGG 290 GEL GLE Y ++ LGP R+ P C LL +L +GG Sbjct: 32 GELRAAGLETVGHYEEVELTESSVNLGPERIGPHCFELLSVLGKGG 77
>SECA_ODOSI (P49649) Preprotein translocase secA subunit| Length = 888 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 126 GWHDIGHFT--SKHSADMYCVFSVEGFVQRHVVIY 28 GW G S++ D Y +F G V RH+VIY Sbjct: 846 GWRKYGQRNPLSEYKEDAYKLFKYRGIVTRHLVIY 880
>CY552_PARDE (P54820) Cytochrome c-552 (Cytochrome c552)| Length = 176 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 108 GQCHASQYTCTPSAAALVEGELADDGLEYVALDGNAD 218 G+ HA YT +A EGE D+G ++ + +AD Sbjct: 43 GEEHAQAYTYPVESAGGAEGEAVDEGPDFATVLASAD 79
>RT04_ACACA (P46755) Mitochondrial ribosomal protein S4| Length = 374 Score = 28.1 bits (61), Expect = 5.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 70 FLRGRFCTASCSNIWTPPPLVIF 2 F++ +C +SCSNI+T L+ F Sbjct: 133 FIKHNYCLSSCSNIYTQTKLLYF 155
>GALT8_HUMAN (Q9NY28) Probable polypeptide N-acetylgalactosaminyltransferase 8| (EC 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase 8) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 8) (Polypeptide GalNAc transferase 8) (GalNAc-T8) (pp-Ga Length = 637 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 58 FHGENTVHICRVFTCK-VANVMPASTLAHLQRQH 156 + GEN RV+ C ++P S +AHL+R H Sbjct: 381 YGGENVELSLRVWQCGGKVEILPCSRIAHLERHH 414
>GIDB_NOCFA (Q5YMS1) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 260 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 141 PSAAALVEGELADDGLEYVALDGNADVER--LGPARVP 248 P+AAALV G+ D Y A VER +GP VP Sbjct: 18 PAAAALVFGDRLDVARRYYDALATAGVERGLIGPREVP 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,675,145 Number of Sequences: 219361 Number of extensions: 779341 Number of successful extensions: 2249 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2249 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)