| Clone Name | rbastl39e06 |
|---|---|
| Clone Library Name | barley_pub |
>PDR1_ORYSA (Q7PC80) Probable pleiotropic drug resistance protein 1| Length = 1468 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 121 NPFPHFS*SVDCCPIWWAWNCTCCSSDFTVF 29 N F F S P+WW W C C +T++ Sbjct: 1373 NLFTGFVISRPATPVWWRWYCWICPVAWTLY 1403
>SODM2_HALME (O08460) Superoxide dismutase [Mn] 2 (EC 1.15.1.1) (Fragment)| Length = 146 Score = 29.3 bits (64), Expect = 2.8 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 153 LIYEGYVQQAAALHVNKHPDAPIWRTWP-NAMHVWE 257 L+Y+ +Q L V KH D +W P A+ VWE Sbjct: 94 LVYDPVTKQLRNLAVQKHNDGALWSAHPILALDVWE 129
>MT_PARLI (P80367) Metallothionein (MT)| Length = 65 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -3 Query: 253 QTCMAFGQVLQIGASGCLFTCSAAAC-CT 170 Q C G+ + GAS C TCS AAC CT Sbjct: 19 QECCITGKCCKDGASVCCGTCSNAACKCT 47
>NIA1_ORYSA (P16081) Nitrate reductase [NADH] 1 (EC 1.7.1.1) (NR1)| Length = 916 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +3 Query: 138 PPMTNLIYEGYVQQAAALHVNKHPDAP--IWRTW 233 PP+ L++ G++ AA +V H P W TW Sbjct: 125 PPLAELMHHGFITPAALHYVANHGAVPRGDWSTW 158
>PDR3_ORYSA (Q8GU90) Pleiotropic drug resistance protein 3| Length = 1457 Score = 28.5 bits (62), Expect = 4.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 82 PIWWAWNCTCCSSDFTVF 29 PIWW W C C +T++ Sbjct: 1375 PIWWRWYCWACPVAWTLY 1392
>PDR2_ORYSA (Q8GU92) Probable pleiotropic drug resistance protein 2| Length = 1464 Score = 28.1 bits (61), Expect = 6.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 82 PIWWAWNCTCCSSDFTVF 29 PIWW W C C +T++ Sbjct: 1382 PIWWRWYCWICPVAWTLY 1399
>PDR4_ORYSA (Q8GU89) Pleiotropic drug resistance protein 4| Length = 1450 Score = 27.7 bits (60), Expect = 8.1 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 82 PIWWAWNCTCCSSDFTVF 29 P+WW W C C +T++ Sbjct: 1367 PVWWRWYCWICPVAWTLY 1384
>THYX_PYRAE (Q8ZWD6) Thymidylate synthase thyX (EC 2.1.1.148) (TS) (TSase)| Length = 244 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 168 YVQQAAALHVNKHPDAPIWRTWPN-AMHVWE 257 Y QA HV A WR WPN A VWE Sbjct: 168 YAAQAEIRHVCWQMFAHAWRLWPNLARLVWE 198
>BCSB2_ACEXY (O82860) Cyclic di-GMP-binding protein precursor (Cellulose| synthase regulatory subunit) (Cellulose synthase protein B) (CDGBP) Length = 802 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 135 LPPMTNLIYEGYVQQAAALHVNKHPDAPIWRTWPNAMHV 251 L P + L EGY A A+ PD WR PN ++V Sbjct: 388 LVPDSALQAEGYAPGALAVPFRVSPDLYTWRDRPNKLNV 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,564,215 Number of Sequences: 219361 Number of extensions: 809341 Number of successful extensions: 2289 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2289 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)