| Clone Name | rbastl39b03 |
|---|---|
| Clone Library Name | barley_pub |
>STR_KLEPN (P13082) Streptomycin 3''-kinase (EC 2.7.1.87) (Streptomycin| 3''-phosphotransferase) (SPH) Length = 266 Score = 31.2 bits (69), Expect = 1.4 Identities = 30/100 (30%), Positives = 38/100 (38%), Gaps = 9/100 (9%) Frame = +1 Query: 181 HFNVTHSNDHGW------GPLSARTLD*SHYFS---FSSPSXXXXXXXXXXXXSTTRKRS 333 H NV D GW G L RT D ++ F+ S P R Sbjct: 157 HENVLDFGDRGWLAIDPHGLLGERTFDYANIFTNPDLSDPG-----------------RP 199 Query: 334 VASAPGISDARL*FVLQLGGWHENH*LALQVALCGSSAAW 453 +A PG +ARL V+ G+ L +A G SAAW Sbjct: 200 LAILPGRLEARLSIVVATTGFEPERLLRWIIAWTGLSAAW 239
>EXOC7_MOUSE (O35250) Exocyst complex component 7 (Exocyst complex component| Exo70) Length = 697 Score = 31.2 bits (69), Expect = 1.4 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 59 YSKFAHRHGSKPNILNPEKYI 121 Y F HR+GS P NPEKYI Sbjct: 658 YGAFLHRYGSVPFTKNPEKYI 678
>SPL11_ARATH (Q9FZK0) Squamosa promoter-binding-like protein 11| Length = 393 Score = 30.8 bits (68), Expect = 1.9 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 329 GASHPHPEFQMPGCDLSFSSAVGTRTTSWLCRSRSVVP 442 G S P P Q+ GC+L SSA G +C S P Sbjct: 167 GQSMPVPRCQIDGCELDLSSAKGYHRKHKVCEKHSKCP 204
>SPS_ORYSA (Q43802) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1049 Score = 30.4 bits (67), Expect = 2.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 324 QTERRIRTRNFRCQAVICPSARRLAREPLVGSAGRAL 434 + R+R R RC + C +A RL PL+ S +AL Sbjct: 933 EMRERMRMRGLRCHLMYCRNATRLQVVPLLASRSQAL 969
>PYRB_NOCFA (Q5YTM0) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate| transcarbamylase) (ATCase) Length = 319 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 380 RTNHSLASEIPGADATLRLRV 318 R +H L +E+PGADA L LRV Sbjct: 212 RVSHHLDAELPGADAVLMLRV 232
>SPS_MAIZE (P31927) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1068 Score = 29.6 bits (65), Expect = 4.1 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 324 QTERRIRTRNFRCQAVICPSARRLAREPLVGSAGRAL 434 + R+R R RC + C ++ RL PL+ S +AL Sbjct: 936 EMRERLRMRGLRCHIMYCRNSTRLQVVPLLASRSQAL 972
>EXOC7_RAT (O54922) Exocyst complex component 7 (Exocyst complex component| Exo70) (rExo70) Length = 653 Score = 28.9 bits (63), Expect = 7.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 59 YSKFAHRHGSKPNILNPEKYI 121 Y F HR+ S P NPEKYI Sbjct: 614 YGAFLHRYSSVPFTKNPEKYI 634 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,321,230 Number of Sequences: 219361 Number of extensions: 1081085 Number of successful extensions: 2497 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2497 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)