| Clone Name | rbastl38g03 |
|---|---|
| Clone Library Name | barley_pub |
>GCP3_DROME (Q9XYP8) Gamma-tubulin complex component 3 homolog (Gamma ring| complex protein 91) (dGrip91) (d91p) Length = 917 Score = 32.7 bits (73), Expect = 0.41 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -2 Query: 419 LNSIAKDYTASLDSFISQLPLQQHVDLKFLLFRLDFTEYYSRVSSN 282 L IA DY ++ +F+ L +L+ RLDF EYY + +N Sbjct: 841 LEVIATDYEKAVSTFLMSLNSSDDPNLQLFGTRLDFNEYYKKRDTN 886
>GCP3_XENLA (O73787) Gamma-tubulin complex component 3 homolog (Gamma ring| complex protein 109) (Xgrip109) (x109p) Length = 906 Score = 31.6 bits (70), Expect = 0.91 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 434 KMGEDLNSIAKDYTASLDSFISQLPLQQHVDLKFLLFRLDFTEYY 300 KM L + Y + F+ L L+FL FRLDF E+Y Sbjct: 841 KMRSQLRILTHFYQGIVQQFLVLLTTSTDESLRFLSFRLDFNEHY 885
>GCP3_HUMAN (Q96CW5) Gamma-tubulin complex component 3 (GCP-3) (Spindle pole| body protein Spc98 homolog) (hSpc98) (hGCP3) (h104p) Length = 907 Score = 31.6 bits (70), Expect = 0.91 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 434 KMGEDLNSIAKDYTASLDSFISQLPLQQHVDLKFLLFRLDFTEYY 300 KM L + Y + F+ L L+FL FRLDF E+Y Sbjct: 842 KMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHY 886
>GCP3_MOUSE (P58854) Gamma-tubulin complex component 3 (GCP-3)| Length = 905 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 434 KMGEDLNSIAKDYTASLDSFISQLPLQQHVDLKFLLFRLDFTEYY 300 KM L + Y + F+ L L+FL FRLDF E+Y Sbjct: 840 KMCSQLRILTHFYQGVVQQFLVLLTTSSDESLQFLSFRLDFNEHY 884
>SPC98_DICDI (Q95ZG4) Spindle pole body component 98 (Spc98) (DdSpc98)| (Fragment) Length = 812 Score = 30.8 bits (68), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -2 Query: 440 FQKMGEDLNSIAKDYTASLDSFISQL---PLQQHVDLKFLLFRLDFTEYYSRVSSN 282 F LN++ ++YT S F S++ + Q ++ L + LDF EYY N Sbjct: 757 FNSFRNHLNNLYQEYTTSFYKFQSEILKVKVNQDLNPISLQYMLDFNEYYEEKKDN 812
>RALB_HUMAN (P11234) Ras-related protein Ral-B| Length = 206 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 217 SKPKAKSDTYFFHIRSTAHTHLLDETRL*YSVKSKRKRRNFKSTCC 354 +K +A D FF + T + E + KS + +++FK CC Sbjct: 159 AKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCC 204
>NUPC_BACSU (P39141) Pyrimidine nucleoside transport protein| Length = 393 Score = 29.3 bits (64), Expect = 4.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -2 Query: 242 VSDLAFGLDLRGILVYTVAPLVDILSVQWHEHI 144 + + FG+ +GIL Y AP ++ + W+E + Sbjct: 268 IFNAVFGISFQGILGYVFAPFAFLVGIPWNEAV 300
>FOLD_HELPY (P56467) FolD bifunctional protein [Includes:| Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] Length = 290 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -2 Query: 419 LNSIAKDYTA--SLDSFISQLPLQQHVDLKFLLFRLD 315 L S+ KDY ++ + QLPL +H+D K +L +D Sbjct: 82 LLSLIKDYNTDQNISGVLVQLPLPRHIDTKMILEAID 118
>SUVR2_ARATH (Q9FNC7) Histone-lysine N-methyltransferase SUVR2 (EC 2.1.1.43)| (Suppressor of variegation 3-9-related protein 2) (Su(var)3-9-related protein 2) (Protein SET DOMAIN GROUP 18) Length = 717 Score = 28.5 bits (62), Expect = 7.7 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +2 Query: 86 AGSNFMASVDKHLQQPRTTECVHAIELTIYQPVGLPYTQEC-LANPNQKLNLTPISSTLE 262 A + F +VD LQ+ +C+ E + L Y +EC L +++ L P L+ Sbjct: 465 AFNGFAYTVDGLLQEDFLEQCIS--EARDPRKQMLLYCKECPLEKAKKEVILEPCKGHLK 522 Query: 263 AQHTLICWTKHGC 301 + CW+K GC Sbjct: 523 RKAIKECWSKCGC 535
>BFR2_YARLI (Q6C9G2) Protein BFR2| Length = 495 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 437 QKMGEDLNSIAKDYTASLDSFISQLPLQQH 348 +++GED+ + +D A L FISQ+ +H Sbjct: 223 EELGEDITNTLQDTKAKLSDFISQIAKMRH 252 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,131,918 Number of Sequences: 219361 Number of extensions: 1339860 Number of successful extensions: 2631 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2631 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)