| Clone Name | rbastl38c11 |
|---|---|
| Clone Library Name | barley_pub |
>YLB5_CAEEL (P46580) Hypothetical protein C34E10.5 in chromosome III| Length = 734 Score = 30.8 bits (68), Expect = 1.7 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -1 Query: 348 SYVRPLPSCALEIETGMPLVTSSCPILTAFLPLHGH-TPEYKSDHMKCVKHFTQRHLRPN 172 SYV+P+ S + + S P L+ +P HG PE D M ++ + Q H+R N Sbjct: 534 SYVKPIMSTHIH----QTIKAQSIPYLSRAIPSHGRGEPELDEDEM-WIQKYPQGHVRNN 588 Query: 171 TD 166 D Sbjct: 589 MD 590
>GLSK_HUMAN (O94925) Glutaminase kidney isoform, mitochondrial precursor (EC| 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) Length = 669 Score = 30.8 bits (68), Expect = 1.7 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -3 Query: 400 WEKAKKGGGDKLIMLPPQLRSSTPFL-----CAGDRNRHAPGDLVMP 275 +E AKK G K+ PQL +P L C D RH+ GD +P Sbjct: 235 YESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVP 281
>GLSK_RAT (P13264) Glutaminase kidney isoform, mitochondrial precursor (EC| 3.5.1.2) (GLS) (L-glutamine amidohydrolase) (K-glutaminase) [Contains: Glutaminase kidney isoform 68 kDa chain; Glutaminase kidney isoform 65 kDa chain] Length = 674 Score = 30.0 bits (66), Expect = 2.9 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -3 Query: 400 WEKAKKGGGDKLIMLPPQLRSSTPFL-----CAGDRNRHAPGDLVMP 275 +E AKK G K+ PQL +P L C D RH+ GD +P Sbjct: 240 YESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVP 286
>IRK14_RAT (O70596) ATP-sensitive inward rectifier potassium channel 14| (Potassium channel, inwardly rectifying subfamily J member 14) (Inward rectifier K(+) channel Kir2.4) (IRK4) Length = 434 Score = 28.9 bits (63), Expect = 6.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 375 PPPFFAFSQLPTFKSAFLFLEESQ 446 PPP FSQ+ +F +AFLF E+Q Sbjct: 120 PPPAPCFSQVASFLAAFLFALETQ 143
>IRK14_MOUSE (Q8JZN3) ATP-sensitive inward rectifier potassium channel 14| (Potassium channel, inwardly rectifying subfamily J member 14) (Inward rectifier K(+) channel Kir2.4) (IRK4) Length = 434 Score = 28.9 bits (63), Expect = 6.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 375 PPPFFAFSQLPTFKSAFLFLEESQ 446 PPP FSQ+ +F +AFLF E+Q Sbjct: 120 PPPAPCFSQVASFLAAFLFALETQ 143
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 28.5 bits (62), Expect = 8.6 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +3 Query: 48 NQEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 227 N + NN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 262 NDLDENNFTTVPLVIDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 228 C----IPVCGHEV 254 C +P+ G+++ Sbjct: 314 CKVKIVPLDGNKL 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,319,209 Number of Sequences: 219361 Number of extensions: 1363238 Number of successful extensions: 2919 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2919 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)