| Clone Name | rbastl38b06 |
|---|---|
| Clone Library Name | barley_pub |
>SPA12_RAT (Q8R4Z1) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 411 Score = 35.4 bits (80), Expect = 0.073 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 13/108 (12%) Frame = +1 Query: 124 EITCTVL*LQGRGNLTATMTMPN---LHLHTACAQT*VKS------CKTMHD*SRP---- 264 +++CT+L + RGN+TAT +P+ L L Q + + K + D P Sbjct: 254 QLSCTILEMPYRGNITATFVLPDSGKLRLLEQGLQADIFAKWKSLLSKRVVDVWVPRLHI 313 Query: 265 TAFSGNQQ*ISTLPLNKLMESHLPLERFSRRPLLISGDLVHEALLNKN 408 +A ++ +S L ++K+ E H L R S L G+ VH+A L N Sbjct: 314 SATYNMKKVLSRLGISKIFEEHGDLTRISSHRSLKVGEAVHKAELRMN 361
>YCF80_GUITH (O78449) Hypothetical 33.2 kDa protein ycf80| Length = 282 Score = 30.0 bits (66), Expect = 3.1 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 33 EILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITG-SWELDSN 176 EI NSR+S KY+ FK I ++YS +T W L SN Sbjct: 216 EIKNILNVNSNSRVSFHPKQKYDKNWFKGIPIFIYSPTVTNLDWTLKSN 264
>CRY2_VIBCH (Q9KS67) Cryptochrome-like protein cry2| Length = 504 Score = 29.6 bits (65), Expect = 4.0 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = -1 Query: 292 SIAGFQRMLWAYSNRASF-CNF*LRSVHRRCE----DVNLAWSSLLSSSHD 155 S+AGF+R L A S+R + C+F ++ CE VN A+ SLL S D Sbjct: 253 SVAGFRRSLIALSSRLHWHCHF-IQKFESECEMEFRCVNRAYDSLLQQSSD 302
>FLHC_YEREN (O86047) Flagellar transcriptional activator flhC| Length = 193 Score = 29.3 bits (64), Expect = 5.2 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -2 Query: 357 PPTKSFKRQMTLHEFVQRQCTDLLLVSRECCGPTLIVHRFATFNSGLCT 211 PP + R TL FV L L CCG T I H NS +C+ Sbjct: 113 PPLLALTRAWTLVRFVDSGM--LQLSGCNCCGGTFITHAHQPRNSFVCS 159
>SPA12_MOUSE (Q7TMF5) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 413 Score = 29.3 bits (64), Expect = 5.2 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 13/105 (12%) Frame = +1 Query: 124 EITCTVL*LQGRGNLTATMTMPN---LHLHTACAQT*VKS------CKTMHD*SRP---- 264 +++CT+L + RGN+TAT +P+ L L Q + + K + D P Sbjct: 254 QLSCTILEIPYRGNITATFVLPDNGKLKLLEQGLQADIFAKWKSLLSKRVVDVWVPKLRI 313 Query: 265 TAFSGNQQ*ISTLPLNKLMESHLPLERFSRRPLLISGDLVHEALL 399 ++ ++ +S L ++K+ E + L R S L G+ VH+A L Sbjct: 314 SSTYNMKKVLSRLGISKIFEENGDLTRISSHRSLKVGEAVHKAEL 358
>WTF7_SCHPO (Q7Z9I5) Hypothetical protein wtf7| Length = 220 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -3 Query: 452 SLYVYLPWNFVLQAPFLFRRASWT 381 SL++ LP+NF+ A FR+AS+T Sbjct: 122 SLFLLLPFNFIFFACLFFRKASFT 145
>Y085_BUCBP (Q89AY5) Hypothetical UPF0011 protein bbp_085| Length = 292 Score = 28.5 bits (62), Expect = 8.9 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = +3 Query: 9 KSLALVTTEILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITGSWELDSNDD 182 K+ L++ +L+T K + +S +K +G +KL +Y+Y++ I + + N+D Sbjct: 236 KNTNLISDAVLKTLKILK-THLSFNKAIKITAGIYKLPKNYLYNYAINNT--ISKNND 290 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,490,005 Number of Sequences: 219361 Number of extensions: 1266829 Number of successful extensions: 2471 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2470 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)