| Clone Name | rbastl38a10 |
|---|---|
| Clone Library Name | barley_pub |
>HAIR_MOUSE (Q61645) Protein hairless| Length = 1182 Score = 30.0 bits (66), Expect = 1.4 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -2 Query: 372 IVDLSSQVQHVGAMES--ISVTVAEDGASHEPDHDLSDVSMSRVFFQLIKA 226 +V S QH + E+ +S + GAS PDH + M R FQ +KA Sbjct: 1123 LVSTISVTQHFLSPETSALSAQLYHQGASLPPDHRMLYAQMDRAVFQAVKA 1173
>GRP78_APLCA (Q16956) 78 kDa glucose-regulated protein precursor (GRP 78) (BiP)| (Protein 1603) Length = 667 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 139 FNKKRKKIQGLLTP-LTVPYRSSGAFSPPLGFDQLKE 246 FN+K+ +++G++ P +T Y SG PP G ++ +E Sbjct: 625 FNEKKTELEGIVQPIMTKLYEQSGGAPPPSGEEESEE 661
>HAIR_RAT (P97609) Protein hairless| Length = 1181 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -2 Query: 372 IVDLSSQVQHVGAMES--ISVTVAEDGASHEPDHDLSDVSMSRVFFQLIK 229 +V S QH + E+ +S + GAS PDH + M R FQ +K Sbjct: 1122 LVSTISVTQHFLSPETSALSAQLCHQGASLPPDHRMLYAQMDRAVFQAVK 1171
>Y2349_CORGL (Q8NN60) Hypothetical UPF0230 protein Cgl2349/cg2579| Length = 274 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -2 Query: 375 RIVDLSSQVQHVGAMESISVTVAEDGASHEPDHDLSDVSMSR 250 R+VD SS VGA + +A+DGAS + +D++ ++ R Sbjct: 92 RVVDTSSLGMAVGAAAMAAARMAKDGASLQECYDIAVDTLKR 133
>DDLB_PSESM (Q87WY7) D-alanine--D-alanine ligase B (EC 6.3.2.4)| (D-alanylalanine synthetase B) (D-Ala-D-Ala ligase B) Length = 319 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 160 IQGLLTPLTVPYRSSGAFSPPLGFDQLK 243 +QGLL L +PY SG + L D+L+ Sbjct: 88 MQGLLECLEIPYTGSGVLASALAMDKLR 115
>SPX_LISMO (Q9RGX0) Regulatory protein spx| Length = 131 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 154 KKIQGLLTPLTVPYRSSGAFSPPLGFDQLKE 246 +K + L +PY+ FS PL D++KE Sbjct: 14 RKARAWLEEHDIPYKERNIFSEPLSLDEIKE 44
>SPX_LISMF (Q71XH4) Regulatory protein spx| Length = 131 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 154 KKIQGLLTPLTVPYRSSGAFSPPLGFDQLKE 246 +K + L +PY+ FS PL D++KE Sbjct: 14 RKARAWLEEHDIPYKERNIFSEPLSLDEIKE 44
>SPX_LISIN (P60377) Regulatory protein spx| Length = 131 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 154 KKIQGLLTPLTVPYRSSGAFSPPLGFDQLKE 246 +K + L +PY+ FS PL D++KE Sbjct: 14 RKARAWLEEHDIPYKERNIFSEPLSLDEIKE 44
>DDL_ANASP (Q8YY71) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 364 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 160 IQGLLTPLTVPYRSSGAFSPPLGFDQL 240 IQGLLT + P+ SG LG D++ Sbjct: 116 IQGLLTLMQTPFVGSGVLGSALGMDKI 142
>TSGA_SHIFL (P59269) Protein tsgA| Length = 393 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 156 FSFLVEVYLKRVTCN-WLFHPL*LCTELRFRFLMALPSSVGTRFSRYRHLF 7 F+FL L + N WL + L T+LRF FL+ + + G FS LF Sbjct: 49 FTFLNAGILISIFLNAWLMEIVPLKTQLRFGFLLMVLAVAGLMFSHSLALF 99
>TSGA_ECOLI (P60778) Protein tsgA| Length = 393 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 156 FSFLVEVYLKRVTCN-WLFHPL*LCTELRFRFLMALPSSVGTRFSRYRHLF 7 F+FL L + N WL + L T+LRF FL+ + + G FS LF Sbjct: 49 FTFLNAGILISIFLNAWLMEIVPLKTQLRFGFLLMVLAVAGLMFSHSLALF 99
>TSGA_ECOL6 (P60779) Protein tsgA| Length = 393 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 156 FSFLVEVYLKRVTCN-WLFHPL*LCTELRFRFLMALPSSVGTRFSRYRHLF 7 F+FL L + N WL + L T+LRF FL+ + + G FS LF Sbjct: 49 FTFLNAGILISIFLNAWLMEIVPLKTQLRFGFLLMVLAVAGLMFSHSLALF 99
>TSGA_ECO57 (Q8X4S4) Protein tsgA| Length = 393 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 156 FSFLVEVYLKRVTCN-WLFHPL*LCTELRFRFLMALPSSVGTRFSRYRHLF 7 F+FL L + N WL + L T+LRF FL+ + + G FS LF Sbjct: 49 FTFLNAGILISIFLNAWLMEIVPLKTQLRFGFLLMVLAVAGLMFSHSLALF 99
>UL24_ILTVT (P23986) Protein UL24 homolog (ORF 3)| Length = 287 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +3 Query: 123 HVSGKLQQEKKKNPRLAHTPNGTLQIIRRVFTSPRL*SAERKPCS 257 H K QQE KN LA LQ + +F+S + KP S Sbjct: 221 HARSKYQQESAKNADLASPAPSALQTVAALFSSRVGKESATKPAS 265
>DDL_RICCN (Q92IT7) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 321 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 160 IQGLLTPLTVPYRSSGAFSPPLGFDQL 240 + GLL + +PY SG S L FD++ Sbjct: 92 LPGLLNIMRIPYTHSGVLSSALAFDKI 118
>DDLB_PSEPK (Q88N74) D-alanine--D-alanine ligase B (EC 6.3.2.4)| (D-alanylalanine synthetase B) (D-Ala-D-Ala ligase B) Length = 318 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 160 IQGLLTPLTVPYRSSGAFSPPLGFDQLK 243 +QGLL L +PY SG + L D+L+ Sbjct: 87 MQGLLECLGIPYTGSGILASALAMDKLR 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,463,174 Number of Sequences: 219361 Number of extensions: 871106 Number of successful extensions: 2191 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2191 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)