| Clone Name | rbastl38a08 |
|---|---|
| Clone Library Name | barley_pub |
>CAF1A_MOUSE (Q9QWF0) Chromatin assembly factor 1 subunit A (CAF-1 subunit A)| (Chromatin assembly factor I p150 subunit) (CAF-I 150 kDa subunit) (CAF-Ip150) Length = 911 Score = 32.0 bits (71), Expect = 0.85 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = -2 Query: 467 RKKPEEKKSTREQKRKDRRSAKERD*IINEILKEE 363 RKK EE+K +E++R+++R E++ + LKEE Sbjct: 344 RKKKEEEKELKEKERREKREKDEKEKAEKQRLKEE 378
>IF2_BACTN (Q8A2A1) Translation initiation factor IF-2| Length = 1040 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKE--RD*IINEILKEEA 360 ++K EEK+ RE+K K R+ K+ ++ II EI KE++ Sbjct: 282 KKKSKEEKRREREEKEKVRQDQKKLMKEAIIKEIRKEDS 320
>CAF1A_HUMAN (Q13111) Chromatin assembly factor 1 subunit A (CAF-1 subunit A)| (Chromatin assembly factor I p150 subunit) (CAF-I 150 kDa subunit) (CAF-Ip150) Length = 938 Score = 30.8 bits (68), Expect = 1.9 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = -2 Query: 467 RKKPEEKKSTREQKRKDRRSAKERD*IINEILKEE 363 +KK EE+K +E++R+++R E++ + LKEE Sbjct: 354 KKKKEEEKELKEKERREKREKDEKEKAEKQRLKEE 388
>IF2_BACFR (Q64ZR4) Translation initiation factor IF-2| Length = 1015 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKE--RD*IINEILKEEA 360 ++K EEK+ RE+K K R+ K+ ++ II EI KE++ Sbjct: 262 KKKSKEEKRKEREEKEKLRQDQKKQMKEAIIKEIRKEDS 300
>IF2_BACFN (Q5LIN1) Translation initiation factor IF-2| Length = 1015 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKE--RD*IINEILKEEA 360 ++K EEK+ RE+K K R+ K+ ++ II EI KE++ Sbjct: 262 KKKSKEEKRKEREEKEKLRQDQKKQMKEAIIKEIRKEDS 300
>GNL3_XENLA (Q7ZX41) Guanine nucleotide-binding protein-like 3| (Nucleostemin-like protein) Length = 542 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKERD*I----INEILKEEACIVLILFVSGLGGGKCAR 306 ++ EKK R++KRK+ ++ + D + +N++L++ IV +L G +C++ Sbjct: 95 KKNNNSEKKEKRDKKRKETKTPDDPDVVLCRQVNKVLEQSDVIVEVLDARDPLGSRCSQ 153
>Y183_UREPA (Q9PQW0) Hypothetical protein UU183| Length = 291 Score = 30.0 bits (66), Expect = 3.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 476 NWRRKKPEEKKSTREQKRKDRRSAKERD*IINEILKE 366 NW+ K+ E K +KRK+++ D I+ EI KE Sbjct: 252 NWKIKQHERKDGLNIKKRKNKQEIVAPDPILEEIFKE 288
>HCP1_BRARE (Q7ZWG6) Heme carrier protein 1| Length = 481 Score = 29.6 bits (65), Expect = 4.2 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = -3 Query: 94 VITVYLGCGEIFLLS*VSSPRCY 26 V+TV+LGC ++++L +S+P C+ Sbjct: 297 VVTVHLGCSDLYVLYELSAPLCW 319
>YCF2_OENHO (Q9MEF2) Protein ycf2| Length = 2280 Score = 29.3 bits (64), Expect = 5.5 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKERD 393 ++KKPE++K + +KRK+++ K ++ Sbjct: 1133 KKKKPEKRKEKKPEKRKEKKPEKRKE 1158 Score = 28.5 bits (62), Expect = 9.4 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKERD 393 + KKPE++K + +KRK+++ K ++ Sbjct: 1165 KEKKPEKRKEKKPEKRKEKKPEKRKE 1190 Score = 28.5 bits (62), Expect = 9.4 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKERD 393 + KKPE++K + +KRK+++ K ++ Sbjct: 1157 KEKKPEKRKEKKPEKRKEKKPEKRKE 1182 Score = 28.5 bits (62), Expect = 9.4 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKERD 393 + KKPE++K + +KRK+++ K ++ Sbjct: 1149 KEKKPEKRKEKKPEKRKEKKPEKRKE 1174 Score = 28.5 bits (62), Expect = 9.4 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -2 Query: 470 RRKKPEEKKSTREQKRKDRRSAKERD 393 + KKPE++K + +KRK+++ K ++ Sbjct: 1141 KEKKPEKRKEKKPEKRKEKKPEKRKE 1166
>BAZ2B_CHICK (Q9DE13) Bromodomain adjacent to zinc finger domain 2B (Extracellular| matrix protein F22) Length = 2130 Score = 28.9 bits (63), Expect = 7.2 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -2 Query: 467 RKKPEEKKSTREQKRKDRRSAKER 396 RKK EEK+ +++KR ++R KER Sbjct: 944 RKKAEEKERLKQEKRDEKRLNKER 967
>PDE1C_RAT (Q63421) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide| phosphodiesterase 1C (EC 3.1.4.17) (Cam-PDE 1C) Length = 768 Score = 28.9 bits (63), Expect = 7.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 473 WRRKKPEEKKSTREQKRKDRRSAKER 396 WR K P+E+K+ +E + K R +A+E+ Sbjct: 581 WRAKVPKEEKAKKEAEEKARLAAEEK 606
>PDE1C_MOUSE (Q64338) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide| phosphodiesterase 1C (EC 3.1.4.17) (Cam-PDE 1C) Length = 706 Score = 28.9 bits (63), Expect = 7.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 473 WRRKKPEEKKSTREQKRKDRRSAKER 396 WR K P+E+K+ +E + K R +A+E+ Sbjct: 521 WRAKVPKEEKAKKEAEEKARLAAEEK 546
>BAZ2B_HUMAN (Q9UIF8) Bromodomain adjacent to zinc finger domain 2B (hWALp4)| Length = 1972 Score = 28.9 bits (63), Expect = 7.2 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -2 Query: 467 RKKPEEKKSTREQKRKDRRSAKER 396 RKK EEK+ +++KR ++R KER Sbjct: 825 RKKAEEKERLKQEKRDEKRLNKER 848
>YBK9_ENCCU (Q8STZ1) Hypothetical protein ECU11_2090| Length = 634 Score = 28.5 bits (62), Expect = 9.4 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 467 RKKPEEKKSTREQKRKDRRSAKERD*IINEILKEE 363 RK+ EE + E+KRK+ AK + ++ + +EE Sbjct: 322 RKRLEEMREMEERKRKEEERAKNEEELLRMVEREE 356
>Y7I5_ENCCU (Q8ST44) Hypothetical protein ECU07_1850/ECU10_0050| Length = 634 Score = 28.5 bits (62), Expect = 9.4 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 467 RKKPEEKKSTREQKRKDRRSAKERD*IINEILKEE 363 RK+ EE + E+KRK+ AK + ++ + +EE Sbjct: 322 RKRLEEMREMEERKRKEEERAKNEEELLRMVEREE 356
>PDE1C_HUMAN (Q14123) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide| phosphodiesterase 1C (EC 3.1.4.17) (Cam-PDE 1C) (hCam-3) Length = 709 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 473 WRRKKPEEKKSTREQKRKDRRSAKER 396 WR K P+E+K+ +E + K R +A+E+ Sbjct: 521 WRAKVPKEEKAKKEAEEKARLAAEEQ 546
>YNX5_CAEEL (P34578) Hypothetical protein T20G5.5 in chromosome III| Length = 1234 Score = 28.5 bits (62), Expect = 9.4 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Frame = -2 Query: 473 WRRKKPE--EKKSTREQKRKDRRSAKERD*IINEILKEEACI-VLILFVSGLGGGKCARL 303 W K E E+K RE++R+ RS +I+ + + + + V ILF G C+ L Sbjct: 148 WLLAKDEDIERKMERERERELSRS------LIHFLFRITSNLFVFILF------GSCSSL 195 Query: 302 LHHEATSITRFLSRMHAFTD 243 L S R LS +H F+D Sbjct: 196 LMERIVSRVRRLSPLHTFSD 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,755,350 Number of Sequences: 219361 Number of extensions: 1280115 Number of successful extensions: 3570 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 3188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3537 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)