| Clone Name | rbastl38a05 |
|---|---|
| Clone Library Name | barley_pub |
>YLAJ_BACSU (O07634) Hypothetical lipoprotein ylaJ precursor| Length = 209 Score = 30.8 bits (68), Expect = 2.2 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 267 VLIKMTSAKAQLTNLEERISRAHPVADILKDLHCILGRVI 386 V+I ++L + IS HPV IL +L I+GRV+ Sbjct: 121 VVIADPDTVSRLREMSREISEGHPVTGILDELAAIVGRVL 160
>VAMPL_ARATH (Q84WF5) Probable VAMP-like protein At1g33485| Length = 255 Score = 30.8 bits (68), Expect = 2.2 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +2 Query: 167 SGAIS----KRKVSKNLPTTTHFEIHICLPLISFNIQGTNQDDISQSAAHQLGGENFQ 328 SG+IS + ++ + L + F+ H CLPL S +I G Q S S A LG N Q Sbjct: 106 SGSISFSNVQDQIVRRLIASLEFD-HTCLPLSSPSIDGAEQSYASNSKAPLLGRSNKQ 162
>SYL1_SULSO (P58176) Leucyl-tRNA synthetase 1 (EC 6.1.1.4) (Leucine--tRNA| ligase 1) (LeuRS 1) Length = 934 Score = 29.6 bits (65), Expect = 4.9 Identities = 14/63 (22%), Positives = 33/63 (52%) Frame = +3 Query: 267 VLIKMTSAKAQLTNLEERISRAHPVADILKDLHCILGRVIQSEIQVEISSRSPDWTFSST 446 V I +TS L +L+ + +P+A+ LK ++ ++ R++ +++ + +W S Sbjct: 639 VRIALTSTSDLLQDLDFNENLVNPIAEQLKKIYDLIDRLLSINTEIKELRTADEWISSKV 698 Query: 447 RRV 455 R + Sbjct: 699 RDI 701
>PGMI_SULSO (Q97WE5) Bifunctional phosphoglucose/phosphomannose isomerase| (Glucose-6-phosphate isomerase) (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Mannose-6-phosphate isomerase) (EC 5.3.1.8) (Phosphomannose isomerase) (PMI) Length = 296 Score = 29.6 bits (65), Expect = 4.9 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = +3 Query: 90 TKRII*SEQNAANYASPPLITIHKSILVQFQKEK*AKICRLPHTLRSTFAYHL*VSTFKV 269 T I +NA S +I IL + KEK K+ ++P ++ +A+ F Sbjct: 71 TSETINDVENAVKAGSEVIIITSGGILEKLAKEKSLKLIKIPSGFQTRYAFPY---LFTP 127 Query: 270 LIKMTSAK 293 LIKMT+ + Sbjct: 128 LIKMTTKR 135
>VPS8_YEAST (P39702) Vacuolar protein sorting-associated protein VPS8| Length = 1274 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +2 Query: 167 SGAISKRKVSKNLP---TTTHFEIHICLPLISFNIQGTNQDDISQS 295 S IS+ K+S NL TTTHF + + P +S Q T + + S Sbjct: 256 SPLISREKISTNLLSVLTTTHFALILLSPHVSLMFQETVEPSVQNS 301
>BC10_RAT (P62950) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 291 WLMSS*LVP*MLKLISGRQMWISKCVVVGKFLLTFLFEIAPEWICEL 151 WL+ L+P L +W S + +G +LL+FL E P IC L Sbjct: 6 WLLPVLLIPKPLN----PALWFSHSMFMGFYLLSFLLERKPCTICAL 48
>BC10_PONPY (Q5R692) Bladder cancer-associated protein homolog (Bladder cancer| 10 kDa protein homolog) (Bc10) Length = 87 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 291 WLMSS*LVP*MLKLISGRQMWISKCVVVGKFLLTFLFEIAPEWICEL 151 WL+ L+P L +W S + +G +LL+FL E P IC L Sbjct: 6 WLLPVLLIPKPLN----PALWFSHSMFMGFYLLSFLLERKPCTICAL 48
>BC10_MOUSE (P62951) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 291 WLMSS*LVP*MLKLISGRQMWISKCVVVGKFLLTFLFEIAPEWICEL 151 WL+ L+P L +W S + +G +LL+FL E P IC L Sbjct: 6 WLLPVLLIPKPLN----PALWFSHSMFMGFYLLSFLLERKPCTICAL 48
>BC10_HUMAN (P62952) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 291 WLMSS*LVP*MLKLISGRQMWISKCVVVGKFLLTFLFEIAPEWICEL 151 WL+ L+P L +W S + +G +LL+FL E P IC L Sbjct: 6 WLLPVLLIPKPLN----PALWFSHSMFMGFYLLSFLLERKPCTICAL 48
>BC10_FELCA (P62953) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 291 WLMSS*LVP*MLKLISGRQMWISKCVVVGKFLLTFLFEIAPEWICEL 151 WL+ L+P L +W S + +G +LL+FL E P IC L Sbjct: 6 WLLPVLLIPKPLN----PALWFSHSMFMGFYLLSFLLERKPCTICAL 48
>BC10_BOVIN (P62954) Bladder cancer-associated protein| Length = 87 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 291 WLMSS*LVP*MLKLISGRQMWISKCVVVGKFLLTFLFEIAPEWICEL 151 WL+ L+P L +W S + +G +LL+FL E P IC L Sbjct: 6 WLLPVLLIPKPLN----PALWFSHSMFMGFYLLSFLLERKPCTICAL 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,516,011 Number of Sequences: 219361 Number of extensions: 1561412 Number of successful extensions: 3631 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3631 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)