| Clone Name | rbastl33e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DNAJ_BORBU (P28616) Chaperone protein dnaJ | 28 | 5.4 | 2 | PRTP_SHV21 (P24911) Probable processing and transport protein | 28 | 5.4 | 3 | TGB2_LVX (P27331) TGB2 protein (Triple gene block 2 protein) (TG... | 28 | 7.0 | 4 | DNAJ_BORGA (Q661A4) Chaperone protein dnaJ | 28 | 7.0 |
|---|
>DNAJ_BORBU (P28616) Chaperone protein dnaJ| Length = 364 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 240 NAFFTLKNDIHGAINSEC*KCLKINSQKSTT*AVC 344 NA+F KN+I+ C CL S+K T+ ++C Sbjct: 131 NAYFGYKNNINITRQMLCDSCLGKKSEKGTSPSIC 165
>PRTP_SHV21 (P24911) Probable processing and transport protein| Length = 679 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/29 (37%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 109 TSPCTR-KLLMYQIYLRCCISFNLKRCVL 26 ++PC+R K +++Q Y CC+S +K C++ Sbjct: 100 SAPCSRHKSIVFQFYNNCCVS--VKMCII 126
>TGB2_LVX (P27331) TGB2 protein (Triple gene block 2 protein) (TGBp2) (12 kDa| protein) (ORF 3 protein) Length = 108 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = -1 Query: 181 DGVTLFRYGVEHRSHQV*GGRRYWTSPCTRKLLMYQIYLRCCISFNLKRCVL 26 DG RYG HRSH + W + T ++ ++ C + + RCVL Sbjct: 52 DGTKRIRYGGPHRSHVPELPAKSW-ALITVVAILIALHFSCLRTHRVHRCVL 102
>DNAJ_BORGA (Q661A4) Chaperone protein dnaJ| Length = 364 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 240 NAFFTLKNDIHGAINSEC*KCLKINSQKSTT*AVC 344 NA+F KN+I+ C CL S+K T+ ++C Sbjct: 131 NAYFGYKNNINITRQILCHSCLGKKSEKGTSPSIC 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,320,813 Number of Sequences: 219361 Number of extensions: 1007113 Number of successful extensions: 1529 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1529 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)