| Clone Name | rbastl33c01 |
|---|---|
| Clone Library Name | barley_pub |
>KPRS1_ENTFA (Q82ZA5) Ribose-phosphate pyrophosphokinase 1 (EC 2.7.6.1) (RPPK 1)| (Phosphoribosyl pyrophosphate synthetase 1) (P-Rib-PP synthetase 1) (PRPP synthetase 1) Length = 323 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFA-CVH 204 DT GT+S+A + LK+AGAK +A C H Sbjct: 230 DTAGTISLAANALKEAGAKDVYASCTH 256
>NU5M_LOCMI (Q36428) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 572 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 131 VSLDYFSVIVHFLFFRQQNCTASYSFCKFFFPL 33 V L + + + FL+F TASYSF F++ + Sbjct: 366 VCLSWVNFFIFFLYFFSTGLTASYSFRLFYYSM 398
>KPRS_STAES (Q8CQU7) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAEQ (Q5HRQ5) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAAW (P65238) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAAS (Q6GBY8) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAAR (Q6GJH1) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAAN (P65237) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAAM (P65236) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255
>KPRS_STAAC (Q5HIH5) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 321 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 127 DTCGTLSVADSDLKQAGAKYWFAC 198 DT GT+++A LK GAK +AC Sbjct: 232 DTAGTITLAAQALKDKGAKEVYAC 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,109,487 Number of Sequences: 219361 Number of extensions: 404610 Number of successful extensions: 843 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)