| Clone Name | rbastl33a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLIGB_ELAQU (Q9PWI3) Phospholipase A2 inhibitor gamma subunit B ... | 30 | 2.5 | 2 | MT_EISFO (P81695) Cadmium-metallothionein (MT) (Fragment) | 29 | 4.3 | 3 | MTXX_METMA (Q8Q083) Putative methyltransferase mtx subunit X (EC... | 28 | 9.7 | 4 | FRIZ4_DROME (Q9NBW1) Protein frizzled-4 precursor (dFz4) | 28 | 9.7 |
|---|
>PLIGB_ELAQU (Q9PWI3) Phospholipase A2 inhibitor gamma subunit B precursor| (PLI-gamma B) Length = 200 Score = 30.0 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 172 RKCCTCDNCK-MPPPVLPGAHKMPSGDQ 252 R CCT D C+ +PPPVL P+G Q Sbjct: 92 RACCTGDECQTLPPPVLEPQVNRPNGLQ 119
>MT_EISFO (P81695) Cadmium-metallothionein (MT) (Fragment)| Length = 75 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 181 CTCDNCK-MPPPVLPGAHKMPSGDQGVRKC*RGPFKIRASTRCTVAEMA 324 C C NC+ + LPG K+ D KC K A+ +C+ A Sbjct: 17 CCCTNCRCLKSECLPGCKKLCCADAEKGKCGNAGCKCGAACKCSAGSCA 65
>MTXX_METMA (Q8Q083) Putative methyltransferase mtx subunit X (EC 2.1.1.-)| Length = 280 Score = 28.1 bits (61), Expect = 9.7 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +2 Query: 233 KCHQVIRGFASASGVLSRSGQAPGVR*LKWHALFVRTCSWPKFLA 367 K VIRG A ASG LS +A G++ + AL + P FLA Sbjct: 81 KVDAVIRGTAKASGTLSSLKKALGMKRICRLALLLTADGTPFFLA 125
>FRIZ4_DROME (Q9NBW1) Protein frizzled-4 precursor (dFz4)| Length = 705 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 194 IAKCHPLSYPVRIKCHQVIRGF 259 I C L VRI+CH V++GF Sbjct: 116 IGPCRSLCESVRIRCHPVLQGF 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,652,870 Number of Sequences: 219361 Number of extensions: 1328902 Number of successful extensions: 3035 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3027 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)