| Clone Name | rbastl33a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NCCH_ALCXX (Q44583) RNA polymerase sigma factor nccH | 30 | 4.7 | 2 | SWD3_YEAST (P38123) COMPASS component SWD3 (Complex proteins ass... | 30 | 4.7 | 3 | MURI_PSEPK (Q88PW2) Glutamate racemase (EC 5.1.1.3) | 29 | 6.2 | 4 | YKE7_YEAST (P36090) Hypothetical 58.9 kDa protein in ELM1-PRI2 i... | 29 | 6.2 | 5 | ISP4_SCHPO (P40900) Sexual differentiation process protein isp4 | 29 | 6.2 |
|---|
>NCCH_ALCXX (Q44583) RNA polymerase sigma factor nccH| Length = 186 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 312 IIQRSTIGSWDTYQALNRAGEMKLPWMFIIKLSRLKDLMELRGIGH 449 I+Q + I +W + + ++ PW+F I L++++DL R + H Sbjct: 50 IVQDTFIAAWHALDDFD-SDKLFRPWLFRIGLNKMRDLRRFRQVRH 94
>SWD3_YEAST (P38123) COMPASS component SWD3 (Complex proteins associated with| SET1 protein SWD3) (Set1C component SWD3) Length = 315 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 474 FISSCWSPDGQCLVAPSGPSALRV 403 F CWSPDGQC+ S ++ + Sbjct: 58 FSELCWSPDGQCIATASDDFSVEI 81
>MURI_PSEPK (Q88PW2) Glutamate racemase (EC 5.1.1.3)| Length = 265 Score = 29.3 bits (64), Expect = 6.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 407 LKAEGPDGATRHWPSGDQQELMK 475 L AEGP GA R W S D + L K Sbjct: 226 LLAEGPAGAARFWTSADPEALRK 248
>YKE7_YEAST (P36090) Hypothetical 58.9 kDa protein in ELM1-PRI2 intergenic| region Length = 516 Score = 29.3 bits (64), Expect = 6.2 Identities = 21/86 (24%), Positives = 34/86 (39%), Gaps = 2/86 (2%) Frame = +2 Query: 140 TSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGV--DVITSMQKALNGVFWYIY 313 T+K +D G +Y ++ +I N + S GV DV + + + IY Sbjct: 92 TAKTTTYDYGIAYFKQNSFDIIENDNRIDRSKVQMFSLGVIIDVQNASSDSKKHFYKEIY 151 Query: 314 YSTVHNRIMGYLSGSK*SWRNETPLD 391 ++ NR YL W + LD Sbjct: 152 HAYAANRYSSYLESLLGQWIRQRDLD 177
>ISP4_SCHPO (P40900) Sexual differentiation process protein isp4| Length = 785 Score = 29.3 bits (64), Expect = 6.2 Identities = 22/92 (23%), Positives = 45/92 (48%) Frame = +2 Query: 110 YKS*RILTISTSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGVDVITSMQKAL 289 Y++ + +ST+ A F L ++ I S + +I+ ++ ++ D+ + KA Sbjct: 400 YQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEI-YDRLRDPPAPDIHEKLMKAY 458 Query: 290 NGVFWYIYYSTVHNRIMGYLSGSK*SWRNETP 385 + V +Y +Y +V G + G+ W+ ETP Sbjct: 459 DEVPFY-WYLSVFLAFFGMMMGTIYGWKTETP 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,471,369 Number of Sequences: 219361 Number of extensions: 1426841 Number of successful extensions: 2971 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2971 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)