| Clone Name | rbastl33a05 |
|---|---|
| Clone Library Name | barley_pub |
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 101 bits (252), Expect = 9e-22 Identities = 47/77 (61%), Positives = 60/77 (77%) Frame = -1 Query: 475 ALXAIPSIDSEAVQQRLDRVRTFYELLNLPFETLLGFIAEQEYLFSAKEYLSILKVNVPG 296 A+ AIP ID E VQQ LDRVRT++ELLN+PFE LL FIAE + +F+ EY ++LKVNVPG Sbjct: 977 AMAAIPYIDGETVQQNLDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPG 1036 Query: 295 REIPMDAERRISQILGH 245 R+ P DA+ R+ +IL H Sbjct: 1037 RDTPSDAQSRLLEILSH 1053
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.37 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +2 Query: 8 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 181 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit ALG14 (EC| 2.4.1.-) (Asparagine linked glycosylation protein 14) Length = 232 Score = 30.0 bits (66), Expect = 3.2 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -1 Query: 427 LDRVRTFYELLNLP-FETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPM 281 L R RT E + L F T+ I+ ++L+ ++ SIL +N PG +P+ Sbjct: 119 LHRARTVGESIILSVFSTVRSLISTIKHLYELPQFPSILLLNGPGTSVPL 168
>SYIC_SCHPO (O13651) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5)| (Isoleucine--tRNA ligase) (IleRS) Length = 1064 Score = 29.3 bits (64), Expect = 5.4 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Frame = -1 Query: 454 IDSEAVQQRLDRVRTFYEL-----------LNLPFETLLGFIAEQEYLFSAK 332 +D E V +R+ R++T EL L P +TL+ + +EYL AK Sbjct: 808 LDDETVLRRVKRMQTIIELARYVREQNNISLKTPLKTLIVILTNEEYLEDAK 859
>WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4)| Length = 539 Score = 28.5 bits (62), Expect = 9.2 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 26 TFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESRGRYC 193 T R K +I+ N SMRQ + + ++KKP ++ Y E+ YC Sbjct: 423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC 478
>DPO3_CLOTE (Q895K2) DNA polymerase III polC-type (EC 2.7.7.7) (PolIII)| Length = 1427 Score = 28.5 bits (62), Expect = 9.2 Identities = 19/67 (28%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +2 Query: 2 VKLHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 181 +K P YH +KNK ++N L+S H KKP + Y+E Sbjct: 596 IKKSPTYHVIILVKNKIGLKNLYKLISESH--------LNHFYKKPRMPKSLINKYREGL 647 Query: 182 --GRYCE 196 G CE Sbjct: 648 MIGSACE 654 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,736,295 Number of Sequences: 219361 Number of extensions: 967081 Number of successful extensions: 2333 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2331 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)