| Clone Name | rbastl33a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHLC_CLOHA (P59026) Phospholipase C precursor (EC 3.1.4.3) (PLC)... | 30 | 2.7 | 2 | BRL2_ARATH (Q9ZPS9) Serine/threonine-protein kinase BRI1-like 2 ... | 30 | 3.5 | 3 | SRB3_CAEEL (Q95ZY2) Serpentine receptor class beta-3 (Protein sr... | 29 | 6.0 | 4 | GPR89_MOUSE (Q8BS95) Protein GPR89A | 28 | 7.9 |
|---|
>PHLC_CLOHA (P59026) Phospholipase C precursor (EC 3.1.4.3) (PLC)| (Phosphatidylcholine cholinephosphohydrolase) (Beta toxin) Length = 399 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 148 WRRTGAKQLTELLNLGLHLRGEMQPPYLP*NL 243 W++ +Q T LL GLH G+ PY P N+ Sbjct: 136 WKKGNYEQATWLLGQGLHYFGDFHTPYHPSNV 167
>BRL2_ARATH (Q9ZPS9) Serine/threonine-protein kinase BRI1-like 2 precursor (EC| 2.7.11.1) (BRASSINOSTEROID INSENSITIVE 1-like protein 2) (Protein VASCULAR HIGHWAY 1) Length = 1143 Score = 29.6 bits (65), Expect = 3.5 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 8/84 (9%) Frame = +3 Query: 54 NNRSLGQLNIPFQTCKTVEWSQIDPNSTSSNLAKDGG--------KATN*TTELRVALEG 209 NN+ G++ F C +EW N + + KD G + N + E Sbjct: 456 NNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPEL 515 Query: 210 GNATTLPTLKSHRMLNYVTGALTP 281 G TTL L + N++TG + P Sbjct: 516 GKCTTLVWLDLN--TNHLTGEIPP 537
>SRB3_CAEEL (Q95ZY2) Serpentine receptor class beta-3 (Protein srb-3)| Length = 341 Score = 28.9 bits (63), Expect = 6.0 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 342 IHFLSLRSIMLHFQNNVHCMLLM-FSCMHM*TQVLC 446 I+F++ + LHF N+ C+L++ F C + + LC Sbjct: 40 IYFITRKIFFLHFHGNLKCLLIVYFICNLLFSMALC 75
>GPR89_MOUSE (Q8BS95) Protein GPR89A| Length = 455 Score = 28.5 bits (62), Expect = 7.9 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +2 Query: 239 ISSNAELCNRSSNAYFHRSCPSWLPFCLMTWGL*DSFSVASQHHASFSEQCPLHAVDVL 415 I SN +L ++ + SC WL F W L D F + S H S + + V V+ Sbjct: 98 IVSNIQLLHKQRLLF---SCLLWLTFMYFFWKLGDPFPILSPKHGILSIEQLISRVGVI 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,414,533 Number of Sequences: 219361 Number of extensions: 1180542 Number of successful extensions: 3112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3112 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)