| Clone Name | rbastl32h11 |
|---|---|
| Clone Library Name | barley_pub |
>YEIU_ECOLI (P76445) Inner membrane protein yeiU| Length = 237 Score = 29.3 bits (64), Expect = 4.4 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +1 Query: 241 VILHEESKFIIIIRNALPSLTAGIRHRIIARYGTPSNTAEQNQLAGDHQSM 393 V+L++ + +I ++ A P+LT +R+ P+ A ++ GDH M Sbjct: 103 VVLNQLGQALIPVKRASPTLTFTDINRVSELLSVPTKDASRDSFPGDHGMM 153
>C8AP2_MOUSE (Q9WUF3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1962 Score = 29.3 bits (64), Expect = 4.4 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +1 Query: 232 PGYVILHEESK--FIIIIRNALPSLTAGIRHRIIA 330 P + ++ E+S FI+ IR A PS + G++H ++A Sbjct: 1507 PMHAVIMEKSNDHFIVKIRRATPSTSPGLKHGVVA 1541
>SHS1_YEAST (Q07657) Seventh homolog of septin 1 (Septation protein 7)| Length = 551 Score = 28.9 bits (63), Expect = 5.8 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = +3 Query: 18 FSSNISEYKNVPATFSY-----YLQSNDQRKLMLPPLGMQLISSYPLPKYISEF 164 F++N+ E K P + Y + SN + K++ P + S +P Y+SEF Sbjct: 39 FANNLLETKIFPHKYQYGKSNASISSNPEVKVIAPTKVVSFNSKNGIPSYVSEF 92
>CEAM1_HUMAN (P13688) Carcinoembryonic antigen-related cell adhesion molecule 1| precursor (Biliary glycoprotein 1) (BGP-1) (CD66 antigen) (CD66a antigen) Length = 526 Score = 28.9 bits (63), Expect = 5.8 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Frame = +3 Query: 225 YISWICN-----SP*RIKVHHHHQECSSLSYCWN-TAPYHCQIWNPKQHCRTEP 368 Y+ WI N SP R+++ + ++ + LS N T PY C+I NP R++P Sbjct: 176 YLWWINNQSLPVSP-RLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDP 228
>PUR4_YERPE (Q8ZCQ2) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1296 Score = 28.1 bits (61), Expect = 9.9 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 302 LLEYGTVSLPDMEPQATLQNRTSSPETINPW 394 LL+YG SLP+ P L T P TI+PW Sbjct: 57 LLQYGP-SLPEHPPAGRLLLVTPRPGTISPW 86
>CDC45_YEAST (Q08032) Cell division control protein 45| Length = 650 Score = 28.1 bits (61), Expect = 9.9 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 10/79 (12%) Frame = +1 Query: 178 PARQNLIATADEIITDISPGYVIL---HE---ESKFIIIIRNALPSL--TAGIR--HRII 327 P+ +N + T D + +I P Y + H +S + NA SL G + H++ Sbjct: 304 PSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMF 363 Query: 328 ARYGTPSNTAEQNQLAGDH 384 AR G P +TA++ L DH Sbjct: 364 ARMGIPLSTAQETWLYMDH 382
>CEA20_HUMAN (Q6UY09) Carcinoembryonic antigen-related cell adhesion molecule 20| precursor Length = 585 Score = 28.1 bits (61), Expect = 9.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 309 NTAPYHCQIWNPKQHCRTEP 368 +T PY C++WN R+EP Sbjct: 318 DTGPYACEVWNWGSRARSEP 337 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,556,060 Number of Sequences: 219361 Number of extensions: 1383939 Number of successful extensions: 3486 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3485 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)