| Clone Name | rbastl32e11 |
|---|---|
| Clone Library Name | barley_pub |
>NOC3L_DROME (Q9VI82) Nucleolar complex protein 3 homolog (NOC3 protein homolog)| (NOC3-like protein) (Nucleolar complex-associated protein 3-like protein) Length = 822 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 109 PTLTKFTIYDSHPQNKIGEGCPPKEMGILHSHNL 210 PT+ + ++ +H GEG P E+G L SH L Sbjct: 721 PTVRRMAVHIAHGVPATGEGALPTEIGKLTSHEL 754
>SRBP1_HUMAN (P36956) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) Length = 1147 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 83 RTLQHQHKYLHSQNLPYMILIHKTKLVKDV 172 R LQH ++ L +NL +HK+K +KD+ Sbjct: 371 RFLQHSNQKLKQENLSLRTAVHKSKSLKDL 400
>THIY_YEAST (Q08579) Putative thiamine transporter YOR192C| Length = 599 Score = 24.3 bits (51), Expect(2) = 6.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 264 LFGKAMYFFLFLFDNWQAEEFPTAARWA 347 L+G+ + + +FDNW + AR A Sbjct: 304 LYGQTFWMPMDIFDNWLTTNYSAGARAA 331 Score = 22.7 bits (47), Expect(2) = 6.7 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +2 Query: 185 WVYYIHIIYWLVGEP-RMQWDFY---SKTCAIWQGNVL 286 WVY I Y V Q DF S CAIW G ++ Sbjct: 244 WVYTISYWYGSVSPGCTNQSDFSRFGSSNCAIWTGTIV 281
>YDB4_SCHPO (Q10357) Hypothetical protein C22E12.04 in chromosome I| Length = 297 Score = 28.1 bits (61), Expect = 9.0 Identities = 18/64 (28%), Positives = 23/64 (35%) Frame = -1 Query: 377 CHLFKNFPSNCPSCCSRELLGLPIIKKEKKEVHCLAK*HRFCCRNPIASLALQPTSKLCE 198 C + PS PSCCS+E KK C ++ + CC S Q C Sbjct: 226 CSKKDSSPSEKPSCCSQEKKSCCSSKKPS----CCSQEKKGCCSTEKTSCCSQEKKSCCT 281 Query: 197 CSIP 186 P Sbjct: 282 SEKP 285
>BT1A1_MOUSE (Q62556) Butyrophilin subfamily 1 member A1 precursor (BT)| Length = 524 Score = 28.1 bits (61), Expect = 9.0 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = +1 Query: 13 FTLPSISLSFYVFPIKNKAECAAKDVATST*IPTLTKFTIY----DSHPQNKIGEGCPPK 180 +T PSIS S + P C K + + K T+ D P + +GEGC Sbjct: 446 YTFPSISFSGPLRPFFCLWSCGKKPLTICSTANGPEKVTVIANVQDDIPLSPLGEGCTSG 505 Query: 181 EMGILHS 201 + LHS Sbjct: 506 DKDTLHS 512 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,740,005 Number of Sequences: 219361 Number of extensions: 1344812 Number of successful extensions: 3205 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3203 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)