| Clone Name | rbastl32e07 |
|---|---|
| Clone Library Name | barley_pub |
>YCF19_CYACA (Q9TM45) Hypothetical 10.5 kDa protein ycf19| Length = 91 Score = 29.3 bits (64), Expect = 4.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -3 Query: 267 LFIVPLLLSLALGWNTATRLHLNPLLSTSDITSPY 163 ++IV +LL ++LGW + P S S ++ PY Sbjct: 18 IYIVLILLRMSLGWFPNINWYSQPFYSLSQLSDPY 52
>YCF19_PORPU (P51353) Hypothetical 10.8 kDa protein ycf19 (ORF95)| Length = 95 Score = 28.5 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 291 LGSSSK-ENLFIVPLLLSLALGWNTATRLHLNPLLSTSDITSPY 163 LGS + ++++ +LL L+L W + P S + IT PY Sbjct: 12 LGSIANFSEIYLILILLKLSLAWFPTVNWYNEPFCSLNRITDPY 55
>HPPA_THETN (Q8RCX1) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 711 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 188 RPATSLAHIDIGKGPSVVVGAYIYICIVYL 99 +P S +DIGK P V +GA+I IVYL Sbjct: 521 KPIDSWFPVDIGK-PEVFIGAFIGAMIVYL 549
>CAPS_DROME (Q9NHE5) Calcium-dependent secretion activator (dCAPS)| Length = 1436 Score = 28.1 bits (61), Expect = 9.4 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +3 Query: 186 SRAADSDVAVSRCSSLEQEKAKEEQ*TGSPLMTNQVQKSRLCFVVFRRLVGRCGSYPFN 362 SRA +S SL EK + + G + +K R+ VF + RC SYPFN Sbjct: 128 SRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVF---ISRCISYPFN 183
>YLD2_CAEEL (Q03567) Hypothetical protein C38C10.2 in chromosome III| Length = 493 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 177 ITSPY*Y--WQGSFGGSRRVYIYMYSLPVFPNDVISL 73 +TSP + W G F G Y + SLP F DV+ L Sbjct: 268 LTSPAVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGL 304
>Y328_MYCGE (Q49419) Hypothetical protein MG328| Length = 756 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 183 WSRAADSDVAVSRCSSLEQEKAKEEQ*TGSPLMTNQVQ 296 W+R+ D+D ++ S EQ+KA +E+ G + Q+Q Sbjct: 462 WTRSKDNDFNNTKNSFEEQKKALDEKLNGLTIQNQQLQ 499 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,214,273 Number of Sequences: 219361 Number of extensions: 1163923 Number of successful extensions: 2919 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2919 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)