| Clone Name | rbastl32e01 |
|---|---|
| Clone Library Name | barley_pub |
>KPK1_PHAVU (P15792) Protein kinase PVPK-1 (EC 2.7.11.1)| Length = 609 Score = 31.2 bits (69), Expect = 1.2 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = +2 Query: 305 GIIHYFPLP----KPSRTPSRASRSYD 373 G+ H+ PLP +PSR P RASR+YD Sbjct: 20 GVHHHDPLPSGTPQPSRPPLRASRNYD 46
>TRPB2_METMA (Q8Q001) Tryptophan synthase beta chain 2 (EC 4.2.1.20)| Length = 442 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 322 KVVYDPLIFFAPSSGEVSCAGSSHTIACAVD 230 K V+D + FA + G V SSH I CA+D Sbjct: 374 KEVFDAAVQFARTEGIVPAPESSHAIRCAID 404
>PDE4A_HUMAN (P27815) cAMP-specific 3',5'-cyclic phosphodiesterase 4A (EC| 3.1.4.17) (DPDE2) (PDE46) Length = 886 Score = 30.4 bits (67), Expect = 2.0 Identities = 23/74 (31%), Positives = 28/74 (37%), Gaps = 11/74 (14%) Frame = +2 Query: 233 HGASNGVGAAGTTNLSARGGEKNKGIIHYFPLPKPSRTPSRASRSYDLPLWAA------- 391 HG G G AG GG + P P P R+P + S L L A Sbjct: 91 HGTGTGSGGAG-------GGSSRRFEAENGPTPSPGRSPLDSQASPGLVLHAGAATSQRR 143 Query: 392 ----YSSDSDWSLS 421 Y SDSD+ +S Sbjct: 144 ESFLYRSDSDYDMS 157
>TRPB2_METAC (Q8TL44) Tryptophan synthase beta chain 2 (EC 4.2.1.20)| Length = 442 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 316 VYDPLIFFAPSSGEVSCAGSSHTIACAVD 230 V+D + FA + G V SSH I CA+D Sbjct: 376 VFDAAVQFARTEGIVPAPESSHAIRCAID 404
>AOC4_ARATH (Q93ZC5) Allene oxide cyclase 4, chloroplast precursor (EC| 5.3.99.6) Length = 254 Score = 28.9 bits (63), Expect = 5.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 330 RSHQEHQAELRGAMTCHYGQRTAATPTGLSRRA 428 R+HQ HQ+ G + QR ++ GLS RA Sbjct: 21 RNHQSHQSTFLGFSRSFHNQRISSNSPGLSTRA 53
>POL_HV2D1 (P17757) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 28.5 bits (62), Expect = 7.7 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 6/82 (7%) Frame = +1 Query: 22 YISLGTYQNTGVRIIINPQKRVGTHL*DIQLVTVWATNFPANIF----LAKLGE--NLYR 183 +I+ Y+N ++++ KRV T+ + P NIF LA LG NL Sbjct: 563 FINTKEYKNVEIKVL---NKRVRA--------TIMTGDTPINIFGRNILATLGMSLNLPV 611 Query: 184 SRPSSVXXXXXPGTTNPRRKQW 249 ++ + PG PR KQW Sbjct: 612 AKLDPIKVTLKPGKDGPRLKQW 633 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,023,797 Number of Sequences: 219361 Number of extensions: 1442228 Number of successful extensions: 3648 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3646 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)