| Clone Name | rbastl32d07 |
|---|---|
| Clone Library Name | barley_pub |
>HNRL1_HUMAN (Q9BUJ2) Heterogeneous nuclear ribonucleoprotein U-like protein 1| (Adenovirus early region 1B-associated protein 5) (E1B-55 kDa-associated protein 5) (E1B-AP5) Length = 856 Score = 33.9 bits (76), Expect = 0.20 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 452 PAYGYTSNPQYQDGYPYAYL---PPPRPSGSYHYPGTGAYSP 336 P Y+ P Q GY Y PPP P +Y+Y G Y+P Sbjct: 753 PQPSYSQPPYNQGGYSQGYTAPPPPPPPPPAYNYGSYGGYNP 794
>HNRL1_MOUSE (Q8VDM6) Heterogeneous nuclear ribonucleoprotein U-like protein 1| Length = 859 Score = 33.5 bits (75), Expect = 0.26 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 452 PAYGYTSNPQYQDGYPYAYL---PPPRPSGSYHYPGTGAYSP 336 P Y+ P Q GY Y PPP P +Y+Y G Y+P Sbjct: 756 PQPSYSQPPYNQGGYTQGYTAPPPPPPPPPAYNYGSYGPYNP 797
>CECR2_HUMAN (Q9BXF3) Cat eye syndrome critical region protein 2| Length = 1484 Score = 31.6 bits (70), Expect = 0.97 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 9/47 (19%) Frame = -3 Query: 452 PAYGYTSNPQYQDGYP---------YAYLPPPRPSGSYHYPGTGAYS 339 P G+ SN + G+P Y+Y PPP+PS +HY T Y+ Sbjct: 1179 PPRGFQSNHPHSGGFPRYRPPQGMRYSYHPPPQPS-YHHYQRTPYYA 1224
>BRO1_GIBZE (Q4IBS9) Vacuolar protein-sorting protein BRO1 (BRO| domain-containing protein 1) Length = 995 Score = 31.6 bits (70), Expect = 0.97 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 446 YGYTSNPQYQDGY-PYAYLPPPRPSG 372 YG +S PQ Q GY P ++PPP P G Sbjct: 916 YGASSTPQTQGGYVPPGFVPPPPPPG 941
>LPP_HUMAN (Q93052) Lipoma-preferred partner (LIM domain-containing preferred| translocation partner in lipoma) Length = 612 Score = 31.2 bits (69), Expect = 1.3 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 452 PAYGYTSNPQYQDGYPYAYLPPPRPSGSYHYPGTGAYSPRRRYY 321 P G P + G YAY+PPP G PG G + RYY Sbjct: 257 PVSGQCPPPSTRGGMDYAYIPPP---GLQPEPGYGYAPNQGRYY 297
>DLX3_HUMAN (O60479) Homeobox protein DLX-3| Length = 287 Score = 31.2 bits (69), Expect = 1.3 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 9/61 (14%) Frame = -3 Query: 443 GYTSNPQ--YQDGYPYAYLPPPRPSGSYHYP-------GTGAYSPRRRYY*QKS*CQFHA 291 GY S PQ Y G PY P +YH+ GTGAYSP+ Y S Q+ A Sbjct: 41 GYYSAPQHDYYSGQPYGQTVNPY---TYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGA 97 Query: 290 F 288 + Sbjct: 98 Y 98
>DLX3_MOUSE (Q64205) Homeobox protein DLX-3| Length = 287 Score = 30.8 bits (68), Expect = 1.7 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 9/49 (18%) Frame = -3 Query: 443 GYTSNPQ--YQDGYPYAYLPPPRPSGSYHYP-------GTGAYSPRRRY 324 GY S PQ Y G PY P +YH+ GTGAYSP+ Y Sbjct: 41 GYYSAPQHDYYSGQPYGQTVNPY---TYHHQFNLNGLAGTGAYSPKSEY 86
>LGE1_YEAST (Q02796) Transcriptional regulatory protein LGE1 (Large cells| protein 1) Length = 332 Score = 30.8 bits (68), Expect = 1.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 449 AYGYTSNPQYQDGYPYAYLPPPRPSGSYHYPGTGAYSPRRR 327 AY Y+S+ Y + Y + PPP PS Y+ G + P R Sbjct: 190 AYPYSSSHTYNN-YHHRETPPPPPSNGYYAKGYPVHVPENR 229
>LEG3_RABIT (P47845) Galectin-3 (Galactose-specific lectin 3) (Mac-2 antigen)| (IgE-binding protein) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) Length = 241 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 419 QDGYPYAYLPPPRPSGSYHYPGTGAYS 339 Q G P AY P +PSG+ YPG YS Sbjct: 73 QPGGPGAYPSPGQPSGAGAYPGASPYS 99
>PRA_MYCLE (P41484) Proline-rich antigen (36 kDa antigen)| Length = 249 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 401 AYLPPPRPSGSYHYP--GTGAYSP 336 +Y PPP P GSY P TGAY+P Sbjct: 59 SYPPPPPPGGSYPPPPPSTGAYAP 82
>PALI_MAGGR (Q51MB1) pH-response regulator protein palI/RIM9| Length = 736 Score = 30.4 bits (67), Expect = 2.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 404 YAYLPPPRPSGSYHYPGTGAYSP 336 Y Y PPP G Y PG G Y P Sbjct: 333 YGYGPPPGSRGGYGPPGRGGYGP 355
>OR8B8_HUMAN (Q15620) Olfactory receptor 8B8 (Olfactory receptor TPCR85)| (Olfactory-like receptor JCG8) Length = 311 Score = 30.0 bits (66), Expect = 2.8 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = +2 Query: 149 FFTRT*IENLSIQTELNVTSFQHQPSSKTTYVSLETANVLYLQYYTRKHGIGTRIFVSSI 328 F+ T + NL + T + + S H P Y +L + Y T K + + +SI Sbjct: 34 FYVVTVVGNLGLITLIRLNSHLHTPMYFFLY-NLSFIDFCYSSVITPKMLMSFVLKKNSI 92 Query: 329 SFAGCMRQ 352 S+AGCM Q Sbjct: 93 SYAGCMTQ 100
>HIC1_MOUSE (Q9R1Y5) Hypermethylated in cancer 1 protein (Hic-1)| Length = 892 Score = 29.3 bits (64), Expect = 4.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 413 GYPYAYLPPPRPSGSYHYPGTGA 345 G P +PPPR GS PGTGA Sbjct: 528 GPPLGLVPPPRYPGSLDGPGTGA 550
>DAZL_CHICK (Q804A9) Deleted in azoospermia-like (DAZ-like protein)| Length = 289 Score = 28.9 bits (63), Expect = 6.3 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 452 PAYGYTSNPQYQDGYPYAY-LPPPRPSGSYHY 360 PAY Y + PQ+ G Y +PP S +YHY Sbjct: 182 PAYNYQAPPQWVPGEQRNYVMPPVYTSVNYHY 213
>OPSD_OCTDO (P09241) Rhodopsin| Length = 455 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -3 Query: 401 AYLPPPRPSG--SYHYPGTGAYSPRRRY 324 AY PPP P G YP GAY P + Y Sbjct: 386 AYQPPPPPQGYPPQGYPPQGAYPPPQGY 413
>SSAA_STAES (Q7CCJ3) Staphylococcal secretory antigen ssaA precursor| Length = 257 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 443 GYTSNPQYQDGYPYAYLPPPRPSGSYHYPGTGAYSPRR 330 GY N D Y Y+Y G+YHY G +SP R Sbjct: 33 GYNPN----DPYSYSYTYTIDAEGNYHYTWKGNWSPDR 66
>SSAA_STAEQ (Q5HLV2) Staphylococcal secretory antigen ssaA precursor| Length = 257 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 443 GYTSNPQYQDGYPYAYLPPPRPSGSYHYPGTGAYSPRR 330 GY N D Y Y+Y G+YHY G +SP R Sbjct: 33 GYNPN----DPYSYSYTYTIDAEGNYHYTWKGNWSPDR 66
>SSAA_STAEP (Q9KJT6) Staphylococcal secretory antigen ssaA precursor| Length = 257 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 443 GYTSNPQYQDGYPYAYLPPPRPSGSYHYPGTGAYSPRR 330 GY N D Y Y+Y G+YHY G +SP R Sbjct: 33 GYNPN----DPYSYSYTYTIDAEGNYHYTWKGNWSPDR 66
>LEG3_CANFA (P38486) Galectin-3 (Galactose-specific lectin 3) (Mac-2 antigen)| (IgE-binding protein) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) Length = 295 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 452 PAYGYTSNPQYQDGYPY---AYLPPPRPSGSYHYPGTGAY 342 PAY + P Q G P AY PP +PS YP G + Sbjct: 113 PAYPGPTAPGTQPGQPSGPGAYPPPGQPSAPGAYPAAGPF 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,298,086 Number of Sequences: 219361 Number of extensions: 1451330 Number of successful extensions: 3778 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 3571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3762 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)