| Clone Name | rbastl32c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG15_DEBHA (Q6BLM0) Putative lipase ATG15 (EC 3.1.1.3) (Autopha... | 28 | 4.0 | 2 | RR4_PROWI (O47032) Plastid 30S ribosomal protein S4 | 28 | 6.9 |
|---|
>ATG15_DEBHA (Q6BLM0) Putative lipase ATG15 (EC 3.1.1.3) (Autophagy-related| protein 15) Length = 615 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 36 RQQVEKHSPKLAELSRCQRSSAKSSNLFQVFTAF 137 ++ +E HS +L EL+ Q S SNL V+ A+ Sbjct: 102 KEYLEAHSEELEELTTMQTSEVDESNLQDVYDAY 135
>RR4_PROWI (O47032) Plastid 30S ribosomal protein S4| Length = 207 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = +1 Query: 4 KHLLNHQHMNIVNRWRSTPLNLPSF-----PGVSVLQLKAQIYFRYLQ 132 + L+NH H+N+ N+ +N+PS+ +SVL+ Q+ YLQ Sbjct: 116 RQLINHGHINVNNK----NINIPSYICKINDIISVLKNSQQLIKNYLQ 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,563,400 Number of Sequences: 219361 Number of extensions: 679891 Number of successful extensions: 1972 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1970 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)