| Clone Name | rbastl31b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous... | 29 | 2.8 | 2 | HNK2_XENLA (P42587) Homeobox protein XENK-2 | 28 | 4.8 | 3 | NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein... | 28 | 6.3 | 4 | FDHE_AQUAE (O67150) Protein fdhE homolog | 28 | 8.2 |
|---|
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 160 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDH 142 + R+ PE ++L TPTQ F +HR+ K+A + KG+ H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 8.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 123 FHDEAFFDKKRWCKNRCEVC 64 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,895,979 Number of Sequences: 219361 Number of extensions: 524156 Number of successful extensions: 1692 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1692 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)