| Clone Name | rbastl30h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HAX1_MOUSE (O35387) HS1-associating protein X-1 (HAX-1) (HS1-bin... | 31 | 1.2 | 2 | VANT_ENTGA (Q9X3P3) Serine/alanine racemase (EC 5.1.1.-) (EC 5.1... | 30 | 2.0 | 3 | SYP41_ARATH (O65359) Syntaxin-41 (AtSYP41) (AtTLG2a) | 29 | 5.9 | 4 | CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated n... | 29 | 5.9 |
|---|
>HAX1_MOUSE (O35387) HS1-associating protein X-1 (HAX-1) (HS1-binding protein)| Length = 280 Score = 31.2 bits (69), Expect = 1.2 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 214 GSSGPFDDLLDTWDVVFLSLLPHFGASEPLDYDSMV 107 GS GPF L DTW V PH A E D DS V Sbjct: 162 GSQGPFHRLDDTWPV-----SPHSRAKEDKDLDSQV 192
>VANT_ENTGA (Q9X3P3) Serine/alanine racemase (EC 5.1.1.-) (EC 5.1.1.1)| (Vancomycin C-type resistance protein vanT) Length = 698 Score = 30.4 bits (67), Expect = 2.0 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 214 GSSGPFDDLLDTWDVVFLSL---LPHFGASEPLDYDSMVLLNRQICTFE 77 G + D +L +D+ FL++ H G+++ L+ DSM+ +QI F+ Sbjct: 467 GVTPTIDSILSIFDLPFLTISGVYSHLGSADRLNPDSMIRTQKQIACFD 515
>SYP41_ARATH (O65359) Syntaxin-41 (AtSYP41) (AtTLG2a)| Length = 322 Score = 28.9 bits (63), Expect = 5.9 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 1/81 (1%) Frame = +3 Query: 183 SNRSSKGPLLPSLHTGIR*AHHQKLERASATSAQQKNMLLRTFSWRR-GSSCTGPLAVEV 359 S RS + PL S TG R + ++TS N S G+S G + V + Sbjct: 16 SLRSVRAPLSSSSLTGTRSGGVGPVIEMASTSLLNPNRSYAPISTEDPGTSSKGAITVGL 75 Query: 360 WPPPWLDDVSDISSNFMNCAT 422 PP W+D +IS N T Sbjct: 76 -PPAWVDVSEEISVNIQRART 95
>CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated neutral| proteinase D) (CANP D) (Small optic lobes protein) Length = 1594 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 136 RHQSVAASLGTQHPRCPTGHQRGHYYHHYI 225 R Q +A SLG + H H++HHY+ Sbjct: 176 RGQDLAGSLGNRGELLAADHSHPHHHHHYL 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,070,483 Number of Sequences: 219361 Number of extensions: 1292301 Number of successful extensions: 3170 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3160 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)