| Clone Name | rbastl30d04 |
|---|---|
| Clone Library Name | barley_pub |
>CFA_ECOLI (P0A9H7) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 31.6 bits (70), Expect = 0.87 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 432 FDEKFIRIWEYYLIFSAACMKARALGDYQVVFSR 331 + E+F R++ YYL A +AR + +QVVFSR Sbjct: 338 YSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_ECOL6 (P0A9H8) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 31.6 bits (70), Expect = 0.87 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 432 FDEKFIRIWEYYLIFSAACMKARALGDYQVVFSR 331 + E+F R++ YYL A +AR + +QVVFSR Sbjct: 338 YSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>PA2G6_RAT (P97570) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 751 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 217 NHMVW*STFLFIEKGFRPCFNH 152 NH W T L +E G R CF+H Sbjct: 115 NHPSWTVTHLAVELGIRECFHH 136
>CFA_CITFR (P45509) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) (Fragment) Length = 89 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 432 FDEKFIRIWEYYLIFSAACMKARALGDYQVVFSR 331 + F R++ YYL A +AR + +QV+FSR Sbjct: 46 YSATFRRMFNYYLCACAGAFRARDIELWQVLFSR 79
>PA2G6_MOUSE (P97819) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 752 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 217 NHMVW*STFLFIEKGFRPCFNH 152 NH W T L +E G R CF+H Sbjct: 116 NHPSWTVTHLAVELGIRECFHH 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,051,960 Number of Sequences: 219361 Number of extensions: 1242981 Number of successful extensions: 2466 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2466 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)