| Clone Name | rbastl29g04 |
|---|---|
| Clone Library Name | barley_pub |
>PSKR_ARATH (Q9ZVR7) Putative phytosulfokine receptor precursor (EC 2.7.11.1)| (Phytosulfokine LRR receptor kinase) Length = 1008 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -1 Query: 347 VLETACRCISTDPRQRPSIEQVVVWLDSV 261 VLE AC C+S +P+QRP+ +Q+V WLD V Sbjct: 980 VLEIACLCLSENPKQRPTTQQLVSWLDDV 1008
>PSKR_DAUCA (Q8LPB4) Phytosulfokine receptor precursor (EC 2.7.11.1)| (Phytosulfokine LRR receptor kinase) Length = 1021 Score = 40.0 bits (92), Expect = 0.001 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = -1 Query: 347 VLETACRCISTDPRQRPSIEQVVVWLDSV 261 VLE ACRC+ +P+ RP+ +Q+V WL+++ Sbjct: 989 VLEIACRCLGENPKTRPTTQQLVSWLENI 1017
>CSMD1_HUMAN (Q96PZ7) CUB and sushi domain-containing protein 1 precursor (CUB and| sushi multiple domains protein 1) Length = 3565 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 229 NWESNTGYYGDTLSSQTTTCSMDGRWRGS 315 +++ N GY + ++S T C+ DGRW S Sbjct: 3061 SYQCNPGYVMEAVTSATIRCTKDGRWNPS 3089
>LIMK1_XENLA (O42565) LIM domain kinase 1 (EC 2.7.11.1) (LIMK-1) (xLIMK1)| Length = 615 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 338 TACRCISTDPRQRPSIEQVVVWLDSV 261 +A C DP +RP Q+ +WLDS+ Sbjct: 550 SAVLCCDLDPEKRPRFSQLQLWLDSL 575
>M3K7_HUMAN (O43318) Mitogen-activated protein kinase kinase kinase 7 (EC| 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1) Length = 606 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 329 RCISTDPRQRPSIEQVV 279 RC S DP QRPS+E++V Sbjct: 265 RCWSKDPSQRPSMEEIV 281
>M3K7_MOUSE (Q62073) Mitogen-activated protein kinase kinase kinase 7 (EC| 2.7.11.25) (Transforming growth factor-beta-activated kinase 1) (TGF-beta-activated kinase 1) Length = 579 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 329 RCISTDPRQRPSIEQVV 279 RC S DP QRPS+E++V Sbjct: 265 RCWSKDPSQRPSMEEIV 281
>NEK3_HUMAN (P51956) Serine/threonine-protein kinase Nek3 (EC 2.7.11.1)| (NimA-related protein kinase 3) (HSPK 36) Length = 506 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 122 TPDKLLHLLVN**FSDSFSTATVYHPCQE 208 TPD LL++L N S +F T T+Y P E Sbjct: 411 TPDTLLNILKNADLSLAFQTYTIYRPGSE 439
>ENV_SIVCZ (P17281) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 854 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 230 TGKATQGITVTRCRAKQRLALWMDAGEG 313 T T GI + CR +Q ++ WM G G Sbjct: 390 TDNITNGIIILPCRIRQIVSSWMRVGRG 417
>TOPK_BRARE (Q6DHU8) T-lymphokine-activated killer cell-originated protein| kinase homolog (EC 2.7.12.2) (PDZ-binding kinase) Length = 339 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 347 VLETACRCISTDPRQRPSIEQVVVWLDSVS 258 ++E C C DP++RPS +V L+S S Sbjct: 297 MVELFCLCTEEDPQKRPSAAHIVQVLESNS 326
>HA2K_MOUSE (P01910) H-2 class II histocompatibility antigen, A-K alpha chain| precursor Length = 256 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 116 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 154
>HA2J_MOUSE (P23150) H-2 class II histocompatibility antigen, I-E alpha chain| precursor (Fragment) Length = 254 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 114 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 152
>HA2D_MOUSE (P04228) H-2 class II histocompatibility antigen, A-D alpha chain| precursor Length = 256 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 116 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 154
>HA2B_MOUSE (P14434) H-2 class II histocompatibility antigen, A-B alpha chain| precursor (IAalpha) Length = 256 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 116 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 154
>PIM1_BRARE (Q9YHZ5) Serine/threonine-protein kinase Pim-1 (EC 2.7.11.1)| Length = 310 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 332 CRCISTDPRQRPSIEQVV 279 C C+S +P RPS+EQ++ Sbjct: 268 CSCLSYNPGDRPSLEQIL 285
>CAS1B_XENLA (P55867) Caspase-1-B precursor (EC 3.4.22.-) (CASP-1-B)| (Interleukin-1 beta convertase homolog B) (xICE-B) Length = 382 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 336 SMQVHQH*PSPASIHRASRCLARQRVTVIPCVA 238 S+ +H+H PSP H ++ +VIPC A Sbjct: 85 SLGLHEHAPSPIQEHNEDTIKDKEINSVIPCSA 117
>HA2S_MOUSE (P14437) H-2 class II histocompatibility antigen, A-S alpha chain| Length = 233 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 93 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 131
>HA2R_MOUSE (P14436) H-2 class II histocompatibility antigen, A-R alpha chain| Length = 233 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 93 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 131
>HA2F_MOUSE (P14435) H-2 class II histocompatibility antigen, A-F alpha chain| Length = 233 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 93 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 131
>HA2Q_MOUSE (P04227) H-2 class II histocompatibility antigen, A-Q alpha chain| (Fragment) Length = 221 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 81 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 119
>HA2U_MOUSE (P14438) H-2 class II histocompatibility antigen, A-U alpha chain| (Fragment) Length = 227 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 307 ASVHP*SKSLFGSTACHRNTLCCFPSSLLVNV*FLTWVINSSS 179 A+V P S L G NTL CF ++ V +TW+ NS S Sbjct: 87 ATVFPKSPVLLGQP----NTLICFVDNIFPPVINITWLRNSKS 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,815,462 Number of Sequences: 219361 Number of extensions: 832736 Number of successful extensions: 1922 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1922 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)