| Clone Name | rbastl29a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YNA8_YEAST (P53983) Hypothetical 76.7 kDa protein in SPO1-SIS1 i... | 29 | 3.5 | 2 | MMHB_AGKHA (Q9YI92) Mamushigin beta chain precursor | 29 | 3.5 | 3 | ZAN_MOUSE (O88799) Zonadhesin precursor | 28 | 4.6 | 4 | DGK1_DROME (Q01583) Diacylglycerol kinase 1 (EC 2.7.1.107) (Digl... | 28 | 4.6 | 5 | TBX11_CAEEL (Q20257) Putative T-box protein 11 | 28 | 6.0 | 6 | APEB_PSEPK (Q88M44) Probable M18-family aminopeptidase 2 (EC 3.4... | 28 | 7.8 |
|---|
>YNA8_YEAST (P53983) Hypothetical 76.7 kDa protein in SPO1-SIS1 intergenic| region Length = 669 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 6 CTVRSRNVKTIN*PCPVSCTDCRKKKSYKG 95 C V RN+ T C C DCR YKG Sbjct: 620 CKVNKRNIVTWPCRCLALCDDCRISLGYKG 649
>MMHB_AGKHA (Q9YI92) Mamushigin beta chain precursor| Length = 146 Score = 28.9 bits (63), Expect = 3.5 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 8/49 (16%) Frame = -1 Query: 212 SECLVLPTDDDNLHRNLWIT--HCVAYRE------STGCSRCVVELCAF 90 +EC+V TD L N WIT C+A + S CSR +C F Sbjct: 96 NECMVEWTDGTRLSHNAWITESECIAAKTTDNQWLSRPCSRTYNVVCKF 144
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = -3 Query: 261 TSLQSPSWLFCS---PVKPL*MSCL 196 T+LQ P+W CS P+KP + C+ Sbjct: 2272 TALQGPAWAHCSSRVPIKPFLLKCM 2296
>DGK1_DROME (Q01583) Diacylglycerol kinase 1 (EC 2.7.1.107) (Diglyceride kinase| 1) (DGK 1) (DAG kinase 1) Length = 1020 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 67 TVEKKNLTKAHNSTTHREQPVLSLYATQCVIHRLRCRLSSSVGKT 201 T+E + T N TT + +S + TQC+ LR +SSS T Sbjct: 566 TMEFGSSTTTTNRTTTTKSISMSTFETQCLQQTLRTAMSSSSSNT 610
>TBX11_CAEEL (Q20257) Putative T-box protein 11| Length = 322 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +1 Query: 25 MSKLSIDPV-LSHVQTVEKKNLTKAHNSTTHREQPVLSLYATQCVIHRLRCRLSSSVGKT 201 + +S D + +++ ++ E N + H T HR PVL++Y ++H R S + T Sbjct: 103 LRNVSFDQIRITNRKSKEDGNASYVHLLTQHRYIPVLTIYEGDQLVHTARIPHSQFISVT 162 Query: 202 RH 207 + Sbjct: 163 AY 164
>APEB_PSEPK (Q88M44) Probable M18-family aminopeptidase 2 (EC 3.4.11.-)| Length = 429 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 262 DFSSESKLVILLSCKTSLNVLSCQRMMITCTVICGSH 152 DF + ++L LLSC L L TC ++C H Sbjct: 228 DFIAGARLDNLLSCYAGLQALLAADSDETCVLVCNDH 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,469,526 Number of Sequences: 219361 Number of extensions: 837548 Number of successful extensions: 2156 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2156 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)