| Clone Name | rbastl28h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MCEL_FOWPV (Q9J584) mRNA capping enzyme large subunit [Includes:... | 33 | 0.45 | 2 | THR_DROME (P42286) Protein three rows | 30 | 3.8 | 3 | DYH1A_CHLRE (Q9SMH3) Dynein-1-alpha heavy chain, flagellar inner... | 28 | 8.6 | 4 | SRB8_YEAST (P25648) Suppressor of RNA polymerase B SRB8 | 28 | 8.6 | 5 | SYT_AGRT5 (Q8UEL1) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threon... | 28 | 8.6 | 6 | HMCT_BOMMO (P98092) Hemocytin precursor (Humoral lectin) | 28 | 8.6 |
|---|
>MCEL_FOWPV (Q9J584) mRNA capping enzyme large subunit [Includes:| Polynucleotide 5'-triphosphatase (EC 3.1.3.33) (mRNA 5'-triphosphatase) (TPase); mRNA guanylyltransferase (EC 2.7.7.50) (GTP--RNA guanylyltransferase) (GTase)] Length = 851 Score = 32.7 bits (73), Expect = 0.45 Identities = 17/64 (26%), Positives = 34/64 (53%) Frame = -2 Query: 219 IRREDLQIFQTCHIYLLLGLSSSTISNMSHIFIIKIVVFNYFKHVTYIYY*DCRLQLFQT 40 ++++D+ T +Y+ +S T SH++I K +F YF H+ YI ++ +T Sbjct: 248 LKKQDIININTDDLYI----TSKTDGIFSHVYIEKKSIFCYFSHLGYIKEYTASREIEET 303 Query: 39 CHIY 28 ++Y Sbjct: 304 IYLY 307
>THR_DROME (P42286) Protein three rows| Length = 1379 Score = 29.6 bits (65), Expect = 3.8 Identities = 17/52 (32%), Positives = 33/52 (63%) Frame = -3 Query: 230 SEQLFGARTFKYFKHVTYIYY*DCRLQLFQTCHIYLLLRLSSSTISNMSHIF 75 +E LFG R+ +FK ++++ + ++F LL+ L+SST SN++++F Sbjct: 187 NESLFGKRSRSFFKSLSFLPS-ESLAKMFNA----LLMLLASSTSSNLANLF 233
>DYH1A_CHLRE (Q9SMH3) Dynein-1-alpha heavy chain, flagellar inner arm I1 complex| (1-alpha DHC) (Dynein-1, subspecies f) Length = 4625 Score = 28.5 bits (62), Expect = 8.6 Identities = 14/42 (33%), Positives = 27/42 (64%) Frame = +3 Query: 243 LFWIILLQNCSFLPFTVLPKQERHAKS*RSAEQAQSELATEK 368 L W++ + N + + TV PK+++ A+S ++ AQ +LA+ K Sbjct: 3381 LKWVLAMVNYNNVARTVEPKRKKVAESEKNLRIAQKDLASTK 3422
>SRB8_YEAST (P25648) Suppressor of RNA polymerase B SRB8| Length = 1427 Score = 28.5 bits (62), Expect = 8.6 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = -1 Query: 361 VANSDCACSALRQLLACLSCLGKTVKGRKEQFCSSIIQNSCDRIRNNY 218 + NS+ CS + L + + + ++ FC+S +QN+ +I +NY Sbjct: 1123 ITNSNDLCSQIFDQLKDMQTIEMITQIVEKDFCTSCLQNNNQKIDDNY 1170
>SYT_AGRT5 (Q8UEL1) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 667 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 GGLQAYKHGLKSFMGMCFILSQFGS 457 G +Q +KHGLKS+ M L++FG+ Sbjct: 349 GHVQIFKHGLKSYREMPVRLAEFGN 373
>HMCT_BOMMO (P98092) Hemocytin precursor (Humoral lectin)| Length = 3133 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 370 CFSVANSDCACSALRQLLACLSCLGKTVKGRKEQFCSSIIQNSCDRIRNNYSA 212 C + A+ +CAC+AL + G T R C CD + +NY + Sbjct: 470 CDAGADCECACAALAAYAHACAHRGVTFNWRTNDLCPM----QCDEVCSNYDS 518 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,918,624 Number of Sequences: 219361 Number of extensions: 1067815 Number of successful extensions: 2661 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2648 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)