| Clone Name | rbastl28g08 |
|---|---|
| Clone Library Name | barley_pub |
>YLK2_CAEEL (P41950) Hypothetical protein D1044.2 precursor| Length = 1090 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 78 RVHTQAFSLF*PAEAEPSSFL-TSSSIPDA--SKESDVQVQQPA*TLHMEPSKPKRPN 242 + HT ++ P EA PS F+ T++ P A + + + VQQP+ ++ +P K + N Sbjct: 884 KAHTTTTTMMIPTEAPPSIFVFTTTQKPRAQSTTQKRIIVQQPSIVVNSQPPKQRNDN 941
>OPAA_NEIGO (Q04876) Opacity protein opA53 precursor (Fragment)| Length = 239 Score = 30.8 bits (68), Expect = 1.4 Identities = 25/71 (35%), Positives = 35/71 (49%) Frame = +2 Query: 203 NSSHGTIQTQATKHNESDHYTHAQT*LGRYLLILIAETSIIHDTFSLPVSQRPPTNCNKS 382 NSSH I+TQ T+H E+ + HA + LG S I+D F L +P + Sbjct: 98 NSSHLNIKTQKTEHQENGTF-HATSSLG---------LSAIYD-FKLNDKFKPYIGVRVA 146 Query: 383 YGYGKGNVAAV 415 YG+ K V +V Sbjct: 147 YGHVKHQVRSV 157
>MATN2_HUMAN (O00339) Matrilin-2 precursor| Length = 956 Score = 29.6 bits (65), Expect = 3.1 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = +1 Query: 67 CTRDACIHR-----PSVFFNLQKQNHLRSSPPAPSPMQAKNQTCRCSNL 198 C+ A HR ++ + QK +H S+ P+ SP++ K+ C+C NL Sbjct: 875 CSNFAVQHRYLFEEDNLLRSTQKLSH--STKPSGSPLEEKHDQCKCENL 921
>RS7_PYRKO (Q5JE04) 30S ribosomal protein S7P| Length = 215 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 4 LQKHLTFRFELQKHVKFRNRWCTRDACIHRPSV 102 + K LT RF + K VK RW D + PS+ Sbjct: 1 MAKPLTERFFIPKEVKVMGRWSVEDVTVEDPSL 33
>GPMI2_METAC (Q8TIY2) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase 2 (EC 5.4.2.1) (Phosphoglyceromutase 2) (BPG-independent PGAM 2) (iPGM 2) Length = 521 Score = 28.9 bits (63), Expect = 5.3 Identities = 19/80 (23%), Positives = 32/80 (40%) Frame = +2 Query: 29 LNCKNMLNLGTDGVQETRAYTGLQSFLTCRSRTIFVPHLQLHPRCKQRIRRAGAATCMNS 208 LN NM +G G+ E A +++ TC R I + +++AG + + Sbjct: 404 LNFANMDMVGHTGIFEA-AVQAVEAVDTCVGRII------------EALKKAGGVALITA 450 Query: 209 SHGTIQTQATKHNESDHYTH 268 HG + +H H H Sbjct: 451 DHGNAEQMENQHTGEPHTAH 470
>JHD3B_HUMAN (O94953) JmjC domain-containing histone demethylation protein 3B| (EC 1.14.11.-) (Jumonji domain-containing protein 2B) Length = 1096 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = -1 Query: 137 ERRW-----FCFCRLKKTEGLCMHASLVHHLFLNLTCFCSSNLNVRC 12 E+RW +C R+KK G C+ S H CS++ +V C Sbjct: 845 EQRWKLKCVYCRKRMKKVSGACIQCSYEH---------CSTSFHVTC 882
>CASR_BOVIN (P35384) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1085 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 137 PHLQLHPRCKQRIRRAGAATCMNSSHGTIQTQATKHNESDHYT 265 P Q PRCKQ++ + S Q A H S H T Sbjct: 961 PQSQQPPRCKQKVIFGSGTVTFSLSFDEPQKTAVAHRNSTHQT 1003
>RS7_THECE (P29159) 30S ribosomal protein S7P| Length = 215 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 4 LQKHLTFRFELQKHVKFRNRWCTRDACIHRPSV--FFNLQ 117 + K LT RF K +K RW D ++ PS+ + NL+ Sbjct: 1 MAKTLTERFYQPKELKVMGRWSVEDVTVNDPSLRPYINLE 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,875,988 Number of Sequences: 219361 Number of extensions: 1329542 Number of successful extensions: 3242 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3241 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)