| Clone Name | rbastl28g07 |
|---|---|
| Clone Library Name | barley_pub |
>Y568_RICPR (Q9ZCY3) Hypothetical protein RP568| Length = 129 Score = 31.2 bits (69), Expect = 0.63 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = +2 Query: 182 SKFKFTHKVTTYNWGICSRFQQFHSENYMSRN*ANIF-------LSPSALVWLY*QFILK 340 S F+ +V+T N+ + S +Q +SEN N NI L P+ L L ++ Sbjct: 20 SLFRIKDRVSTLNYQLRSVIKQINSEN----NNINILKAEQAYLLLPTRLEKLAAAYLKL 75 Query: 341 EVVFKCEVVLDPLAP 385 E+V +++ DPLAP Sbjct: 76 EIVKSYQMINDPLAP 90
>CNOT3_HUMAN (O75175) CCR4-NOT transcription complex subunit 3 (CCR4-associated| factor 3) Length = 753 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 385 WCQRIKNDFTFEYNFLED 332 W QR K FTFEY +LED Sbjct: 732 WGQRKKEGFTFEYRYLED 749
>CNOT3_MOUSE (Q8K0V4) CCR4-NOT transcription complex subunit 3 (CCR4-associated| factor 3) Length = 751 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 385 WCQRIKNDFTFEYNFLED 332 W QR K FTFEY +LED Sbjct: 730 WGQRKKEGFTFEYRYLED 747
>YZ2T_AGRVI (O34299) Hypothetical protein in TAR-II ttuC' 3'region (ORFZ2)| (Fragment) Length = 242 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 50 WGMPSSQFLGNLDLIQLKVQTEGIWI 127 WG+ +S ++GNL L+ L + G+W+ Sbjct: 97 WGIIASMWIGNLLLVILNLPLIGLWV 122
>DEMA_PONPY (Q5R4B6) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 125 SRCPQSEP*AELDPDFLETGNWACPMNLMIHSNKW 21 S+ P ++P P +ET W CP +L + +W Sbjct: 171 SKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEW 205
>DEMA_MOUSE (Q9WV69) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 125 SRCPQSEP*AELDPDFLETGNWACPMNLMIHSNKW 21 S+ P ++P P +ET W CP +L + +W Sbjct: 171 SKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEW 205
>DEMA_HUMAN (Q08495) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 125 SRCPQSEP*AELDPDFLETGNWACPMNLMIHSNKW 21 S+ P ++P P +ET W CP +L + +W Sbjct: 171 SKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEW 205
>YZ2R_AGRVI (P70795) Hypothetical 52.8 kDa protein in TAR-I ttuC' 3'region| (ORFZ2) Length = 502 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 50 WGMPSSQFLGNLDLIQLKVQTEGIWI 127 WG+ +S ++GNL L+ L + G+W+ Sbjct: 357 WGIIASMWIGNLLLVILNLPLIGLWV 382
>PPAY_CAEEL (Q10944) Putative acid phosphatase B0361.7 precursor (EC 3.1.3.2)| Length = 422 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 348 TTSLRMNCQYNQTRALGLRKMFAQ 277 T + MN Q+ T+A G+RK FA+ Sbjct: 154 TAEIEMNAQWKSTKANGIRKKFAR 177
>MTH_DROYA (Q9GT50) G-protein coupled receptor Mth precursor (Protein| methuselah) Length = 517 Score = 27.3 bits (59), Expect = 9.1 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 3/79 (3%) Frame = +2 Query: 2 FQCCIKSIYLNVSSNSWGMPSSQFLGNLDLIQLKVQTEGIWI*FSLRFRLRARTSNAHNS 181 + C+ YL + N W M + + L V +W+ + +AHN+ Sbjct: 256 YMVCLFMAYLLLLLNLWQMSQNFCITAGFLGYFFVMAAFLWLSVISLHLWNTFSGSAHNA 315 Query: 182 SKFKFTHKVTTYN---WGI 229 ++F H+ YN WG+ Sbjct: 316 NRFLSEHRFLAYNTYAWGM 334 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,709,358 Number of Sequences: 219361 Number of extensions: 850420 Number of successful extensions: 1677 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1677 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)