| Clone Name | rbastl28e04 |
|---|---|
| Clone Library Name | barley_pub |
>ATP6_AEDAL (Q5JCK5) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 32.0 bits (71), Expect = 0.70 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 249 WKSFMFFLWRCYNLHMFLHVV 187 W SFM + W C+ HMF H+V Sbjct: 111 WLSFMLYGWICHTQHMFAHLV 131
>PQE1_CAEEL (Q10124) Putative RNA exonuclease pqe-1 (PolyQ enhancer protein 1)| Length = 1647 Score = 30.8 bits (68), Expect = 1.6 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 56 NTHHIEFGPARQESIQPCQALPQIPRAIRGAQNPANSSPVRLSH 187 N H G Q S QP Q +PR + Q + SPVR SH Sbjct: 148 NAHQPTAGQIPQSSNQPAQQTHNVPRMPQPLQQVPHPSPVRGSH 191
>IDI_BRELN (Q9KK75) Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) (IPP| isomerase) (Isopentenyl pyrophosphate isomerase) (IPP:DMAPP isomerase) Length = 182 Score = 29.6 bits (65), Expect = 3.5 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 287 ILTRDNLRKRNWPGNPSCSFCG 222 ++TR L+KR WPG + SFCG Sbjct: 45 LVTRRALKKRTWPGVWTNSFCG 66
>CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cyclase (EC| 4.6.1.1) (ATP pyrophosphate-lyase) (Protein rutabaga) Length = 2248 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -2 Query: 163 IGRILGTSYCPRNLWQSLTWLYAFLPGRSKFYMMCIAAVCWVIWDV 26 +G L + PR L L +L+AF+ + ++ + W+IWD+ Sbjct: 717 LGAALQVTALPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDI 762
>ATRX_CAEEL (Q9U7E0) Transcriptional regulator ATRX homolog (EC 3.6.1.-)| (ATP-dependent helicase xnp-1) (X-linked nuclear protein 1) Length = 1359 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 110 QALPQIPRAIRGAQNPANSSPVRLSHTT*RNM 205 Q LP IP +RG + N+ +RL H T R M Sbjct: 1285 QILPYIPDEMRGGMSEFNTHFIRLVHETDRKM 1316 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,131,033 Number of Sequences: 219361 Number of extensions: 1468188 Number of successful extensions: 3216 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3215 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)