| Clone Name | rbastl28d07 |
|---|---|
| Clone Library Name | barley_pub |
>Y418_METJA (Q57861) Hypothetical protein MJ0418| Length = 257 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = -3 Query: 123 VYKIAAVC*CIRLDNIFPDVDTIMGSWRYNFVPINGEMQ 7 +YK A VC I L+ FP TI+G W + P NGE++ Sbjct: 44 MYKCAWVCEKI-LNKNFPLNATIIGKWTLSKKPFNGEVK 81
>METE_PYRAB (Q9V085) Probable methylcobalamin:homocysteine methyltransferase| (EC 2.1.1.-) (Methionine synthase) Length = 338 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 195 DSTPFLVGTLNRA-RGIVVKIGMHFVY 118 D P V +NRA +GI +K+G+H Y Sbjct: 187 DEVPLAVEAINRAVKGIKIKVGLHVCY 213
>POLG_TBEVW (P14336) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3414 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 215 VVYNAFAANLTFLLPWQDEPY--ACPVLLCSS*HQLRTDQNWLEYVRIWGA 361 ++ N F N ++ W+D PY +LCSS R W + IWGA Sbjct: 3330 ILDNPFMQNKERVMEWRDVPYLPKAQDMLCSSLVGRRERAEWAK--NIWGA 3378
>YTH3_CAEEL (P54002) Putative glycosyl transferase C14A4.3 in chromosome II (EC| 2.-.-.-) Length = 603 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 222 TMPSLLISLFCCHGRMSLMHALCYYAAVNTSSGRTKIGWSMCASGAHL 365 T+ L I LFC G A+C +N ++GR I +S+ +SG L Sbjct: 135 TLIRLTIGLFCLLGEYYAFDAIC--KKINIATGRFFILFSIFSSGMFL 180
>VATI_AERPE (Q9YEA0) V-type ATP synthase subunit I (EC 3.6.3.14) (V-type ATPase| subunit I) Length = 686 Score = 27.3 bits (59), Expect = 9.0 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 5/91 (5%) Frame = +2 Query: 134 PILTTIPLARFRVPTRKGVES-SYPA*M----VVYNAFAANLTFLLPWQDEPYACPVLLC 298 PI + + L +F P + VE YP V+ A LTF L + D VLL Sbjct: 321 PIPSKVDLPQFLKPFSRVVELYGYPEPNEIVPTVFLAITLPLTFALMFPDAGQGLLVLLF 380 Query: 299 SS*HQLRTDQNWLEYVRIWGAPTPCLGVGGG 391 S + R ++W + + G + G+ G Sbjct: 381 SLFYLRRVSRDWAYVIAVMGGASVVSGLLAG 411
>THI5_YEAST (P43534) Pyrimidine precursor biosynthesis enzyme THI5| Length = 340 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 242 LTFLLPWQDEPYACPVLLCSS 304 +TFLL WQ PY P+ L + Sbjct: 6 ITFLLNWQPTPYHIPIFLAQT 26
>THI13_YEAST (Q07748) Pyrimidine precursor biosynthesis enzyme THI13| Length = 340 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 242 LTFLLPWQDEPYACPVLLCSS 304 +TFLL WQ PY P+ L + Sbjct: 6 ITFLLNWQPTPYHIPIFLAQT 26
>THI12_YEAST (P42883) Pyrimidine precursor biosynthesis enzyme THI12| Length = 340 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 242 LTFLLPWQDEPYACPVLLCSS 304 +TFLL WQ PY P+ L + Sbjct: 6 ITFLLNWQPTPYHIPIFLAQT 26
>THI11_YEAST (P47183) Pyrimidine precursor biosynthesis enzyme THI11| Length = 340 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 242 LTFLLPWQDEPYACPVLLCSS 304 +TFLL WQ PY P+ L + Sbjct: 6 ITFLLNWQPTPYHIPIFLAQT 26
>CDC7_YEAST (P06243) Cell division control protein 7 (EC 2.7.11.1)| Length = 507 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 393 PPPPTPKQGVGAPQMRTYSSQFWSVLSWC 307 P P T V A +++ Y + WS WC Sbjct: 414 PDPKTNMDAVDAYELKKYQEEIWSDHYWC 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,990,277 Number of Sequences: 219361 Number of extensions: 1167377 Number of successful extensions: 2794 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2791 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)