| Clone Name | rbastl28a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KHSE_STRMU (Q8DUG4) Homoserine kinase (EC 2.7.1.39) (HSK) (HK) | 29 | 2.4 | 2 | LYST_HUMAN (Q99698) Lysosomal trafficking regulator (Beige homolog) | 27 | 9.2 |
|---|
>KHSE_STRMU (Q8DUG4) Homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 288 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 316 SLTLLDSVYIPPDASCHRIRMAS*TPLAIGSG 221 +L L+ ++ + PD HR+RM S PLA G G Sbjct: 53 NLLLVTALKVAPDLRPHRLRMVSDIPLARGLG 84
>LYST_HUMAN (Q99698) Lysosomal trafficking regulator (Beige homolog)| Length = 3801 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 35 HISETLAKIVKLWCLQRCVSESALMIHQMRFTGRTTQKGRKIKQKTKN 178 H+SE + V LW C+ E+ TT+KG+KIK++ K+ Sbjct: 1468 HLSEGFS--VSLWFNVECIHEAE----------STTEKGKKIKKRNKS 1503 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,091,662 Number of Sequences: 219361 Number of extensions: 862413 Number of successful extensions: 1939 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1936 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)