| Clone Name | rbastl27h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OR2_ANOGA (Q8WTE6) Odorant receptor Or2 (AgOr2) | 30 | 3.2 | 2 | TRCB_XENLA (Q91854) Beta-TrCP (Beta-transducin repeat-containing... | 28 | 9.2 |
|---|
>OR2_ANOGA (Q8WTE6) Odorant receptor Or2 (AgOr2)| Length = 378 Score = 29.6 bits (65), Expect = 3.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 189 YVHEMTDVSIIHHMCLLLFFSFYFRRCVLV 100 YVH++ S++ H+CLL F SF C L+ Sbjct: 243 YVHDLN--SLVTHLCLLEFLSFGMMLCALL 270
>TRCB_XENLA (Q91854) Beta-TrCP (Beta-transducin repeat-containing protein)| Length = 518 Score = 28.1 bits (61), Expect = 9.2 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = -2 Query: 302 QCGQVSVTESMISKWMDYKVPKVNYHMCKSWPLPYIMCTYMK*QMCQSFITCACCYSFHF 123 +C QV E +IS+ Y+ +N TY+K + + FIT Sbjct: 75 ECDQVEFVEHLISRMCHYQHGHIN--------------TYLKPMLQRDFITALPARGLDH 120 Query: 122 ISEDVCLFLGIK-LC 81 I+E++ +L K LC Sbjct: 121 IAENILSYLDAKSLC 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,442,560 Number of Sequences: 219361 Number of extensions: 1156625 Number of successful extensions: 2341 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2341 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)