| Clone Name | rbastl27d10 |
|---|---|
| Clone Library Name | barley_pub |
>ASPM_FELCA (P62288) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3461 Score = 32.3 bits (72), Expect = 0.54 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 133 YNIRRQNKRW-IMNQ*RELIQLYISINNSGRLRMHTHCR*NLSTKALALYIQSQIRSTNL 309 Y + Q K+W IM + LIQ+Y GR + + L TKA + IQS RS + Sbjct: 1982 YRMHVQQKKWDIMKKAARLIQMYYRAYRIGRRQRQLY----LKTKAAIVIIQSAYRSMRV 2037 Query: 310 TTQLPE 327 ++ E Sbjct: 2038 RKKIKE 2043
>ACBA_ACTS5 (Q9ZAE7) Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)| (dTDP-glucose synthase) (dTDP-glucose pyrophosphorylase) Length = 303 Score = 32.0 bits (71), Expect = 0.70 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 307 DWWSGFEIGCIERAPWSRGFIDSVYACA 224 D G +IGC+E A W GF+D+ + A Sbjct: 240 DEGQGIKIGCVEEAAWRAGFLDTAHVRA 267
>DRP2B_ARATH (Q9LQ55) Dynamin-2B (EC 3.6.5.5) (Dynamin-related protein 2B)| (Dynamin-like protein 3) Length = 920 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 440 SSSRRTPNRLPPAPPR 393 SS R TPNRLPPAPP+ Sbjct: 898 SSRRTTPNRLPPAPPQ 913
>DRP2A_ARATH (Q9SE83) Dynamin-2A (EC 3.6.5.5) (Dynamin-related protein 2A)| (Dynamin-like protein 6) Length = 914 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 440 SSSRRTPNRLPPAPP 396 S+ R TPNRLPPAPP Sbjct: 892 SNRRTTPNRLPPAPP 906
>RFBA1_KLEPN (Q48475) O-antigen export system permease protein rfbA| Length = 259 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 377 LVSMIYYYVFLLGTRSVSGNWVVRLVERI*DWMYRASA 264 L +MIYY++F L R N+ V L+ + W + AS+ Sbjct: 44 LFAMIYYFIFKLVMRVQIPNYTVFLITGLFPWQWFASS 81
>TILS_CHLTR (O84847) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 321 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 155 LFWRLMLYKCFLGSFMGHPA 96 LF+RL KCF G F+GH A Sbjct: 107 LFYRLCKEKCFSGVFLGHHA 126
>PRT1_ARATH (Q8LBL5) Ubiquitin protein ligase PRT1 (EC 6.3.2.-) (Proteolysis 1| protein) Length = 410 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/65 (24%), Positives = 27/65 (41%) Frame = +2 Query: 242 VDETSRPRRSLYTSNLKSAPPISPPNYQKQSVCLARIHNNKSWILISTTSISVALAATDL 421 V+E S L +S+ + P P N + +H N+ L+ +S ++ DL Sbjct: 134 VEECSNAANLLSSSSSRGDIPCIPKNQEPTDAKALNVHENE---LLKDNKVSKQISKDDL 190 Query: 422 ACVGC 436 C C Sbjct: 191 LCSAC 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,396,085 Number of Sequences: 219361 Number of extensions: 1320640 Number of successful extensions: 3081 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3081 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)