| Clone Name | rbastl27d01 |
|---|---|
| Clone Library Name | barley_pub |
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 33.9 bits (76), Expect = 0.095 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 190 NQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRPA 294 N+T ET H HHHSRH H H + RP+ Sbjct: 16 NETDRETNHSRRHRHHHSRHRESKHGRHDRSERPS 50
>SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Selenoprotein| Se-P10; Selenoprotein Se-P6; Selenoprotein Se-P2; Selenoprotein Se-P1] Length = 385 Score = 31.6 bits (70), Expect = 0.47 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 196 TGCETFHPGTENHHHSRHGNPGHPCHFGTHRPAQS 300 T +T P E++HH H GH H G+ +P+++ Sbjct: 193 TASKTTEPSEEHNHHKHHDKHGHE-HLGSSKPSEN 226
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 166 HCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGTHRPAQSLLCQHSQTSH 330 H HP E H HHH H P H H G H H H Sbjct: 79 HHHPEEHHEPHHEEHHHHHPHPHHHHHHHPPHHHHHLGHHHHHHHAAHHHHHEEH 133 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 214 HPGTENHHHSRHGNPGHPCHFGTH 285 H G +HHH HG+ H H H Sbjct: 221 HHGHHHHHHHHHGHHHHHHHHHGH 244
>CAUP_DROME (P54269) Homeobox protein caupolican| Length = 693 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +1 Query: 118 YQTSNFYRACLGSPCVHCHPL*TRNQTGCETFHPGTENHHHSRHGNPGHPCHFGT 282 Y NFY + PL Q + ++HHH H +P H G+ Sbjct: 480 YLGQNFYPPSSADQQLPHQPLQQHQQQQLQQLQQQQQHHHHPHHHHPHHSMELGS 534
>GSC_DROME (P54366) Homeobox protein goosecoid| Length = 419 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 220 GTENHHHSRHGNPGHPCHFGTHRPAQ 297 G +H H HG+P HP H G H Q Sbjct: 247 GHGHHPHHPHGHPHHP-HLGAHHHGQ 271
>TRK1_SACBA (P28569) High-affinity potassium transport protein| Length = 1241 Score = 28.1 bits (61), Expect = 5.2 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 7/109 (6%) Frame = +1 Query: 97 ARNLSQIYQTSNFYRACLGSPCVHCH--PL*TRNQTGCETFHPGT----ENHHHSRHGNP 258 AR+L+++ +T +F + + H P R + F G +H++ +GN Sbjct: 602 ARDLNELARTPDFQKMVYKNWKAHHRNKPNFKRRGWNGKMFEHGPYTSDSDHNYQDNGNN 661 Query: 259 GHPC-HFGTHRPAQSLLCQHSQTSHRRGDRLVTIQSSPATFPYWTSLDH 402 + H+ A+S+L H SHR G V+ S+ T+P + DH Sbjct: 662 SNSIVHY-----AESIL--HRDNSHRNGSEDVSSDSNETTYPLNGNNDH 703
>ERC2_MOUSE (Q6PH08) ERC protein 2 (CAZ-associated structural protein 1) (CAST1)| Length = 957 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 205 ETFHPGTENHHHSRHGNPGHPCHFGTHRPA 294 E H +HHH H +PG H HRP+ Sbjct: 918 EDHHHYHHHHHHHHHRSPGRSQH-SNHRPS 946
>LAB_DROME (P10105) Homeotic protein labial (F24) (F90-2)| Length = 635 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +1 Query: 250 GNPGHPCHFGTHRPAQSLLCQHSQTSHRRGDRLVTI----QSSPAT 375 GNPG P H +H PA S S S+ + T+ SSP T Sbjct: 135 GNPGTPLHPSSHSPADSYYESDSVHSYYATAAVATVAPPSNSSPIT 180
>YDH3_PLAFS (P14589) Hypothetical protein 3' to Asp-rich and His-rich proteins| (Fragment) Length = 53 Score = 27.7 bits (60), Expect = 6.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 320 WLCWQRRLWAGRW 282 W CW+RR W RW Sbjct: 13 WWCWRRRGWRRRW 25
>Y2392_ARCFU (O30279) Hypothetical protein AF2392| Length = 86 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -2 Query: 284 WVPK*QGWPGFPWRLWWWF---SVPGW 213 W+P GW G WR WW+ +PGW Sbjct: 4 WMP---GWGGRGWR--WWYRATGLPGW 25
>POL_HV1RH (P05959) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix protein| p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1435 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = -2 Query: 377 KVAGELCIVTRRSPR-----RWEVWLCWQRRLWAGRWVPK 273 KVA E ++ ++P+ + E W W W W+P+ Sbjct: 961 KVATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPE 1000
>LRCH1_HUMAN (Q9Y2L9) Leucine-rich repeats and calponin homology| domain-containing protein 1 (Calponin homology domain-containing protein 1) (Neuronal protein 81) (NP81) Length = 728 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 214 HPGTENHHHSRHGNPGHP 267 HP +HHH HG G P Sbjct: 25 HPHHHHHHHQHHGGTGAP 42
>POU23_BRARE (P79745) POU domain protein ZP-23| Length = 443 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 187 RNQTGCETFHPGTENHHHSRHGNPGHPCHFG 279 +N +G + H GT HH + H P H H G Sbjct: 119 KNNSGRDDLHSGTALHHRAPHLGP-HQTHAG 148
>POL_HV1N5 (P12497) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix protein| p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/40 (25%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = -2 Query: 377 KVAGELCIVTRRSPR-----RWEVWLCWQRRLWAGRWVPK 273 K+A E ++ ++P+ + E W W W W+P+ Sbjct: 960 KIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPE 999
>POL_HV1MA (P04588) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix protein| p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1439 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/40 (25%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = -2 Query: 377 KVAGELCIVTRRSPR-----RWEVWLCWQRRLWAGRWVPK 273 K+A E ++ ++P+ + E W W W W+P+ Sbjct: 965 KIAQESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPE 1004
>PKNA2_BIFLO (Q8G4G1) Probable serine/threonine-protein kinase pknA2 (EC| 2.7.11.1) Length = 757 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/16 (56%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = -2 Query: 239 WWWFSVPG--WKVSQP 198 WWWF+ PG W V +P Sbjct: 445 WWWFAGPGSYWSVPKP 460 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,917,342 Number of Sequences: 219361 Number of extensions: 972529 Number of successful extensions: 2978 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2934 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)