| Clone Name | rbastl27c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-rela... | 30 | 1.9 | 2 | IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-r... | 29 | 2.5 | 3 | PFP_AMYMD (Q9AGC0) Pyrophosphate--fructose 6-phosphate 1-phospho... | 28 | 7.3 | 4 | CLH_YEAST (P22137) Clathrin heavy chain | 28 | 7.3 |
|---|
>IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-related| T-cell-derived-inducible factor) (IL-TIF) (IL-TIF alpha) (Interleukin-22a) (IL-22a) Length = 179 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 149 SSSILLVVLWAVENSSYPVASWCKVE 226 +S +LL+ LWA E ++ PV + CK+E Sbjct: 18 ASCLLLIALWAQEANALPVNTRCKLE 43
>IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-related| T-cell-derived-inducible factor beta) (IL-TIFb) (IL-TIF beta) Length = 179 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 149 SSSILLVVLWAVENSSYPVASWCKVE 226 +S +LL+ LWA E ++ P+ + CK+E Sbjct: 18 ASCLLLIALWAQEANALPINTRCKLE 43
>PFP_AMYMD (Q9AGC0) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase| (EC 2.7.1.90) (6-phosphofructokinase, pyrophosphate dependent) (Pyrophosphate-dependent 6-phosphofructose-1-kinase) (PPi-dependent phosphofructokinase) (PPi-PFK) Length = 341 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +2 Query: 53 HTKFYS*TQSVIFKTLGRHDGFMGMHSNPSYNSSSILL 166 HT S ++++ + +GRH G++ +HS + +S IL+ Sbjct: 154 HTTAESHHRALVVEVMGRHAGWIALHSGLAGGASVILV 191
>CLH_YEAST (P22137) Clathrin heavy chain| Length = 1653 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 124 SHKTIMSSQCLENYTLCLGIEFCMVFNNRMSANSPWLVGVY 2 S K + + LENYT I+ C+V N + + WLVG + Sbjct: 623 SEKAGLYQRALENYTDIKDIKRCVVHTNALPID--WLVGYF 661 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,649,521 Number of Sequences: 219361 Number of extensions: 1173565 Number of successful extensions: 2435 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2434 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)