| Clone Name | rbastl27a09 |
|---|---|
| Clone Library Name | barley_pub |
>YIID_ECOLI (P0ADQ2) Hypothetical protein yiiD| Length = 329 Score = 32.0 bits (71), Expect = 0.43 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 150 LFNGSMFSLYNFTAFGLCWMHLPVKNLSCFLVLPSMDVK 34 LF GS+FSL T +GL W+ L ++L ++L ++ Sbjct: 219 LFAGSLFSLATLTGWGLIWLMLRERHLGGTIILADAHIR 257
>YIID_ECOL6 (P0ADQ3) Hypothetical protein yiiD| Length = 329 Score = 32.0 bits (71), Expect = 0.43 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 150 LFNGSMFSLYNFTAFGLCWMHLPVKNLSCFLVLPSMDVK 34 LF GS+FSL T +GL W+ L ++L ++L ++ Sbjct: 219 LFAGSLFSLATLTGWGLIWLMLRERHLGGTIILADAHIR 257
>YIID_ECO57 (P0ADQ4) Hypothetical protein yiiD| Length = 329 Score = 32.0 bits (71), Expect = 0.43 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 150 LFNGSMFSLYNFTAFGLCWMHLPVKNLSCFLVLPSMDVK 34 LF GS+FSL T +GL W+ L ++L ++L ++ Sbjct: 219 LFAGSLFSLATLTGWGLIWLMLRERHLGGTIILADAHIR 257
>HST4_SCHPO (Q9UR39) NAD-dependent deacetylase hst4 (EC 3.5.1.-) (Homologous to| SIR2 protein 4) Length = 415 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/62 (24%), Positives = 29/62 (46%) Frame = +2 Query: 8 SVIHSIVQSFTSMLGKTRKHDKFLTGRCIQHRPNAVKLYKENIDPLKRSWDALATILPTP 187 ++ H++++ + R D L + ++LY +NID L+ + L T +P P Sbjct: 113 NIFHAMIRKLHMLSNNARPTDFHLFLSQLAQESKLLRLYTQNIDFLETRLEGLQTCIPLP 172 Query: 188 FS 193 S Sbjct: 173 QS 174
>CTL4_HUMAN (Q53GD3) Choline transporter-like protein 4 (Solute carrier family| 44 member 4) Length = 710 Score = 28.9 bits (63), Expect = 3.6 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -1 Query: 254 VFHPQLINYCLSVQPSAFFVLRTEWEVLLPKH--PSSFLMDRCFPYTISLHSACVGCT 87 VF+ + N+CL P V+ + + L P PS+ + RCFP+T A G T Sbjct: 139 VFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNITPPALPGIT 196
>Y1519_METJA (Q58914) Hypothetical protein MJ1519| Length = 1175 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 23 IVQSFTSMLGKTRKHDKFLTGRCIQHRPNAVKLYKENIDPLKR 151 IV+ F + + DK+LT I RP+ +K + E + +K+ Sbjct: 228 IVEEFNKFREENQDFDKYLTDENIAFRPHVMKKFDEFAENIKK 270
>PORCN_HUMAN (Q9H237) Probable protein-cysteine N-palmitoyltransferase porcupine| (EC 2.3.1.-) (Protein MG61) Length = 461 Score = 28.5 bits (62), Expect = 4.7 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 6/74 (8%) Frame = -3 Query: 255 CFSPPTNQLLPECTALSIFCV------ENGVGSIVAKASQLLFNGSMFSLYNFTAFGLCW 94 C P Q L + L C+ G+ S + AS + G FSLY+F + W Sbjct: 17 CLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVA--GGFFSLYHFFQLHMVW 74 Query: 93 MHLPVKNLSCFLVL 52 + L +L C+LVL Sbjct: 75 VVL--LSLLCYLVL 86
>ABTB2_RAT (O08764) Ankyrin repeat and BTB/POZ domain-containing protein 2| (Confluent 3Y1 cell-associated protein) (CCA3) Length = 1009 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 47 LGKTRKHDKFLTGRCIQHRPNAVKLYKENIDPLKRSWDALATILP 181 L ++ + + L QHR A Y +++ SWD + T+LP Sbjct: 32 LSSSKSNSQALNSSAPQHRGAAWWCYSGSMNSRHNSWDTVNTVLP 76
>ABTB2_MOUSE (Q7TQI7) Ankyrin repeat and BTB/POZ domain-containing protein 2| Length = 1024 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 47 LGKTRKHDKFLTGRCIQHRPNAVKLYKENIDPLKRSWDALATILP 181 L ++ + + L QHR A Y +++ SWD + T+LP Sbjct: 32 LSSSKSNSQALNSSAQQHRGAAWWCYSGSMNSRHNSWDTVNTVLP 76
>RP1L1_MOUSE (Q8CGM2) Retinitis pigmentosa 1-like 1 protein (Retinitis| pigmentosa 1-like protein 1) Length = 1859 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 145 KKELGCFGNNTSHSVLNTKNAEGCTLRQ 228 + E GC+G N SV++++ G LRQ Sbjct: 255 RSERGCWGPNAKQSVIHSRGRSGGKLRQ 282
>PORCN_MOUSE (Q9JJJ7) Probable protein-cysteine N-palmitoyltransferase porcupine| (EC 2.3.1.-) (mPORC) Length = 461 Score = 27.7 bits (60), Expect = 8.1 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 6/74 (8%) Frame = -3 Query: 255 CFSPPTNQLLPECTALSIFCV------ENGVGSIVAKASQLLFNGSMFSLYNFTAFGLCW 94 C P Q L + L C G+ S + AS + G FSLY+F + W Sbjct: 17 CLLPTVQQGLDQIWLLLTICFACRLLWRLGLPSYLKHASTVA--GGFFSLYHFFQLHMVW 74 Query: 93 MHLPVKNLSCFLVL 52 + L +L C+LVL Sbjct: 75 VVL--LSLLCYLVL 86
>DYHC_PARTE (Q27171) Dynein heavy chain, cytosolic (DYHC) (DHC08)| Length = 4540 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 125 KENIDPLKRSWDALATIL 178 ++NIDP K WDA TIL Sbjct: 4131 RQNIDPSKLPWDAFRTIL 4148
>NOP14_CANGA (Q6FNV1) Probable nucleolar complex protein 14| Length = 799 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 26 VQSFTSMLGKTRKHDKFLTGRCIQHRPNAVKLY----KENIDPLKRSWD 160 V+S + + +K +K HRP A+ Y +EN +P K+S+D Sbjct: 670 VESIEEKIKRMKKLNKHYPLALQAHRPTAIPSYAPKFEENFNPAKKSYD 718
>YP9C_CAEEL (Q09248) Hypothetical protein C28H8.12| Length = 331 Score = 27.7 bits (60), Expect = 8.1 Identities = 22/84 (26%), Positives = 33/84 (39%) Frame = +2 Query: 5 NSVIHSIVQSFTSMLGKTRKHDKFLTGRCIQHRPNAVKLYKENIDPLKRSWDALATILPT 184 +S + + Q ML K K D+ I N K E ++ L + WD + LP+ Sbjct: 203 HSYVSGLEQRLNMMLTKLEKIDETRANNDIDE--NLDKKVDEILE-LMQKWDVACSSLPS 259 Query: 185 PFSTQKMLRAVHSGNS*LVGGEKH 256 + K L +H GG H Sbjct: 260 NVNKVKALNRLHEQVQHFAGGLSH 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,221,940 Number of Sequences: 219361 Number of extensions: 821916 Number of successful extensions: 1964 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1964 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)