| Clone Name | rbastl27a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocy... | 87 | 2e-17 | 2 | Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA int... | 33 | 0.36 | 3 | RP54_BACSU (P24219) RNA polymerase sigma-54 factor | 30 | 3.1 | 4 | ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit... | 30 | 3.1 | 5 | WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4) | 28 | 8.9 |
|---|
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 87.0 bits (214), Expect = 2e-17 Identities = 39/64 (60%), Positives = 51/64 (79%) Frame = -1 Query: 464 QQRLDRVRTFYELLNLPFETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPMDAERRISQ 285 QQ LDRVRT++ELLN+PFE LL FIAE + +F+ EY ++LKVNVPGR+ P DA+ R+ + Sbjct: 990 QQNLDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRDTPSDAQSRLLE 1049 Query: 284 ILGH 273 IL H Sbjct: 1050 ILSH 1053
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.36 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 36 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 209 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>RP54_BACSU (P24219) RNA polymerase sigma-54 factor| Length = 436 Score = 30.0 bits (66), Expect = 3.1 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +3 Query: 9 NTRSLILLKLHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKK 164 NTRS + LHP+Y T + + S Q+T + LS + Q +L Q+K+ Sbjct: 248 NTRSFPEIDLHPQYRT---LLSSGSCQDTVSYLSAKYQEWRWLSRALRQRKQ 296
>ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit ALG14 (EC| 2.4.1.-) (Asparagine linked glycosylation protein 14) Length = 232 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -1 Query: 455 LDRVRTFYELLNLP-FETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPM 309 L R RT E + L F T+ I+ ++L+ ++ SIL +N PG +P+ Sbjct: 119 LHRARTVGESIILSVFSTVRSLISTIKHLYELPQFPSILLLNGPGTSVPL 168
>WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4)| Length = 539 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +3 Query: 54 TFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESRGRYC 221 T R K +I+ N SMRQ + + ++KKP ++ Y E+ YC Sbjct: 423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,002,476 Number of Sequences: 219361 Number of extensions: 937197 Number of successful extensions: 2187 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2185 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)